Procedure documentenbeheer

Maat: px
Weergave met pagina beginnen:

Download "Procedure documentenbeheer"

Transcriptie

1 Proceduredocumentenbeheer Proceseigenaar: Kwaliteitscoördinator Eindverantwoordelijk: Directie Akkoorddoor: <Naamondertekenaar> Functie: Datum: Qmus Procedure Documentenbeheer.doc Pagina 1 van 5

2 1. Doelvanhetproces Hetopgecontroleerdewijzetotstandbrengenvannieuweengewijzigdedocumenteninhetkwaliteitssysteem. 2. Definities Kwaliteitsdocument: Documentdatdeeluitmaaktvanhetbeschrevenkwaliteitssysteem. Kwaliteitscoördinator: Demedewerkerdiebelastismetdecoördinatievandeactiviteiten vooruitlopendopenvoortkomenduithetkwaliteitsbeleidvande instelling.dekwaliteitscoördinatoradviseerthetmanagement. Externedocumenten: Alledocumentendiebuitendeinstellingzijnontwikkeld enbinnendeorganisatiewordengebruikt. Procesverantwoordelijke: Defunctionarisdieverantwoordelijkisvoorhetproceswaarhet documentbijhoort. 3. Functies,verantwoordelijkhedenenbevoegdheden Functie Verantwoordelijkheden Bevoegdheden Kwaliteitscoördinator Directie/ managementteam Procesverantwoordelijke Wijzigingsvoorstelindienen Archiverenvervallendocumenten/opnemen inregistervervallendocumenten Plaatsennieuw/gewijzigddocumentenin kwaliteitshandboek/opkwaliteitsschijf Verspreidennieuwedocumenten Verantwoordelijkvoorhetvrijgevenvan documenten Hij/zijisverantwoordelijkvoordeinhoudvan eendocumentvanzijn/haarproces.hij/zij fiatteertdocumentendiebijzijn/haarproces horen. Medewerker Indienenvoorsteltotwijziging/nieuw document ICT Back up(kwaliteits)documenten Makenvanaanpassingen inhetkwaliteitssysteem Beherenvandocumenten Beoordelen wijzigingsvoorstel/ nieuwdocument Fiatterenvanalle documenten Beoordelen wijzigingsvoorstel/ nieuwdocument Fiatterenproces document Qmus Procedure Documentenbeheer.doc Pagina 2 van 5

3 4. Stroomschemadocumentenbeheer interneaudits directie beoordelingen initiatiefvan medewerkers 1. Indienenvoorstel 2. Beoordelen voorstel 3. Plaatsennieuw documentin kwaliteitssysteem 4. Archiveren gewijzigde documenten 5. Informerenvan medewerkers Qmus Procedure Documentenbeheer.doc Pagina 3 van 5

4 5. Toelichtingstroomschema 1.Indienenvoorstel Opbasisvaninterneaudits,directiebeoordelingenofanderszinskunnenkwaliteitscoördinatoren,MT s, proceseigenarenenoverigemedewerkerseenvoorsteltotnieuwedocumentenofwijzigingvandocumenten indienen.voorhetindienenvaneenvoorstelwordteenformuliervoorstelnieuwe/gewijzigdeformulieren gebruikt.hetformulierwordtingeleverdbijdekwaliteitscoördinator. 2.Beoordelenvoorstel Hetvoorstelwordthetmanagementbeoordeeldopwenselijkheid,inhoudenconsistentiemetderestvanhet kwaliteitssysteem. 3.Plaatsennieuwdocumentinhetkwaliteitssysteem NagoedkeuringdoorhetMTplaatstdekwaliteitscoördinatornieuween/ofgewijzigdedocumentenopdeinterne schijfen/ofneemtdezeopinhetkwaliteitshandboek. Toelichting:Soortendocumenten Inhetkwaliteitssysteemzijndevolgendesoortendocumententeonderscheiden: SoortdocumentIdentificatie Kwaliteitshandboek (hetbeleids niveau) KHB Procedures (hetwat niveau) PRO Werkinstructies (hethoe niveau) WI Formulieren idem FO Protocollen idem PROT Documenten idem DOC Overigen idem OV Degeldendedocumentenhebbenverschillende soorten niveaus,teweten: PRI =Primair Documentenvandeprimaireprocessententoonstellen encollectieenhunsubprocessen OND =Ondersteunend Documentenvandeondersteundeprocessen (bijv.huisvesting,personeel,ictenz. SYS =Systeem Documentendiehetkwaliteitssysteemintacthouden, (bijvoorbeeldverslagenvaninterneaudits,eenverbeteroverzicht,e.d.) Devolgordevancoderingvaneendocumentisalsvolgt.Jesteltvast: 1. ofheteenpro,ofdoc,protenzbetreft; 2. ofhetpri,ofond,ofsysbetreft; 3. bijwelkprocesofsubproceshetdocumenthoort. Dedocumentenkrijgenookdeinitialenvandeinstelling. Eencoderingkanerdusalsvolgtuitzien: PRO.PRI.B&D.TT DitisdeproceduretentoonstellenvanhetBelasting&Douanemuseum. PRO.SYS.B&D.INTERNEAUDITS DitisdeprocedureinterneauditsvanhetBelasting&Douanemuseum Qmus Procedure Documentenbeheer.doc Pagina 4 van 5

5 4.Archiverengewijzigdedocumenten Oudedocumentenwordenopgenomenineenregistergewijzigdedocumenten. Beheervandocumenten Hetbeheervandedocumenteninhetkwaliteitssysteemisdeverantwoordelijkheidvandekwaliteitscoördinator. Deafdelingsysteembeheerisverantwoordelijkvooreenregelmatigeback upvandedigitale kwaliteitsdocumenten. Destatusvanpapierendocumenten Kwaliteitsdocumentenkunneneenmaliguitgeprinteninterngebruiktworden.Dedigitaleversievaneen kwaliteitsdocumentisaltijdleidend. Externedocumenten Degebruikers/beheerdersvanexternedocumentenzijnverantwoordelijkvoorhetbeheerenhetup to date houdenvanexternedocumenten. 5.Informerenvanmedewerkers Dekwaliteitscoördinatorinformeertmedewerkersoverwijzigingeninhetkwaliteitssysteem.Hetmanagementis verantwoordelijkvoorhetfiatterenenuitgevenvanhetdocument,voordegoedestaatvanhetkwaliteitssysteem envoordetoegankelijkheidervan. Bijlagen FO.SYS.<NAAMINSTELLING>formuliervoorstelnieuwe/gewijzigdeformulieren DOC.SYS.<NAAMINSTELLING>hetoverzichtvantehanterendocumentenengewijzigdedocumenten Qmus Procedure Documentenbeheer.doc Pagina 5 van 5

Proceseigenaar: Kwaliteitscoӧrdinator Eindverantwoordelijk: Akkoord door: Functie: Datum: Procedure interne audit

Proceseigenaar: Kwaliteitscoӧrdinator Eindverantwoordelijk: Akkoord door: <Naam ondertekenaar> Functie: Datum: Procedure interne audit Procedureinterneaudit Proceseigenaar: Kwaliteitscoӧrdinator Eindverantwoordelijk: Directie Akkoorddoor: Functie: Datum: 110214 PRO.SYS Qmus Procedure Interne audit.doc Pagina 1 van

Nadere informatie

Plan van aanpak. Qmus model. voor de ontwikkeling en implementatie van een kwaliteitssysteem op basis van het

Plan van aanpak. Qmus model. voor de ontwikkeling en implementatie van een kwaliteitssysteem op basis van het Planvanaanpak voordeontwikkelingenimplementatie vaneenkwaliteitssysteem opbasisvanhet Qmusmodel QmusiseenconceptvanMuseumadviesElsThijssenenontwikkeldinsamenwerkingmet CharlottevanRappard(Collectieconsult),

Nadere informatie

Procedure klachtenbehandeling

Procedure klachtenbehandeling Procedure enbehandeling Proceseigenaar: Eindverantwoordelijk: Directie Kwaliteitscoördinator Akkoord door: Functie: Datum: 110214 Qmus Klachtenprocedure.doc Pagina 1 van 5 1 Doel van

Nadere informatie

Model procedure tentoonstellen

Model procedure tentoonstellen Model procedure tentoonstellen Proceseigenaar: Hoofd Publiek / Projectleider tentoonstellen Akkoord door: Functie: Datum: 101125 DEF Qmus Model PRO Tentoonstellen.doc Pagina 1 van

Nadere informatie

Model procedure registratie & documentatie

Model procedure registratie & documentatie Model procedure registratie & documentatie Proceseigenaar: Hoofd collectie Akkoord door: Functie: Datum: 101125 DEF Qmus Model PRO Registratie en Documentatie.doc Pagina 1 1. Doel

Nadere informatie

9 Documenten. 9.1 t/m 9.3 beheer van documenten. Statusoverzicht. Voorgenomen besluit Bestuursgroep OR. Vastgesteld door Bestuursgroep

9 Documenten. 9.1 t/m 9.3 beheer van documenten. Statusoverzicht. Voorgenomen besluit Bestuursgroep OR. Vastgesteld door Bestuursgroep Statusoverzicht. Consultatie 1 Consultatie 2 Voorgenomen besluit Bestuursgroep OR q Instemming q Advies q N.v.t. Vastgesteld door Bestuursgroep N.v.t. N.v.t. Borging. Implementatie m.i.v. Opgenomen in

Nadere informatie

Verantwoordelijken voor de uitleg van het kwaliteitsmanagementsysteem aan de medewerkers en voor het volgen van de procedures etc.

Verantwoordelijken voor de uitleg van het kwaliteitsmanagementsysteem aan de medewerkers en voor het volgen van de procedures etc. KH-A-06.3 17-04-2009 Pagina 1 van 3 Datum vaststelling : 17-04-2009 Evaluatie datum : 17-04-2011 Eigenaar : Beleidsmedewerker Vastgesteld door : MT Datum aanpassingen aan : 20-01-2015 1. BETREFT, zodanig

Nadere informatie

NAN 2006 Richtlijn 9 Documenten

NAN 2006 Richtlijn 9 Documenten NAN 2006 Richtlijn 9 Documenten Versie: 26 februari 2007 Auteur: KNMP/WINAp Leeswijzer richtlijn 9 Deze richtlijn is een uitwerking van hoofdstuk 9 van de NAN 2006 en gaat over het bewaren en vernietigen

Nadere informatie

Evaluatie en verbetering kwaliteitsysteem

Evaluatie en verbetering kwaliteitsysteem Evaluatie en verbetering kwaliteitsysteem Versie : 00-00-00 Vervangt versie : 00-00-00 Geldig m.i.v. : Opsteller : ------------------- Pag. 1 van 5 Goedkeuringen : Datum: Paraaf: teamleider OK/CSA : DSMH

Nadere informatie

Opstellen, beheren, wijzigen, verspreiden en actueel houden van BIP kwaliteitsdocumenten. BPR 15 versie 12 ingangsdatum 01-03-2013 pag.

Opstellen, beheren, wijzigen, verspreiden en actueel houden van BIP kwaliteitsdocumenten. BPR 15 versie 12 ingangsdatum 01-03-2013 pag. BPR 15 versie 12 ingangsdatum 01-03-2013 pag. 1 van 8 versie datum toelichting 10 21-03-2011 In deze versie is de lay-out aangepast aan de XML opmaak met een verandering van indeling van hoofdstukken,

Nadere informatie

Model procedure onderzoek en publicatie

Model procedure onderzoek en publicatie Model procedure onderzoek en publicatie Proceseigenaar: Hoofd Collectie/ hoofd Publiek Akkoord door: Functie: Datum: 101125 DEF Qmus Model PRO Onderzoek en Publicatie.doc Pagina 1

Nadere informatie

1. Documenten en informatie beheren

1. Documenten en informatie beheren Het Managementsysteem Onderwijs (MMS-O) is een intranetapplicatie waarmee het mogelijk is om op een gebruiksvriendelijke wijze een managementinformatiesysteem voor een of meerdere scholen op te zetten.

Nadere informatie

Procedure PR01-1/5. Raad van Bestuur Documentenbeheer Datum: 15/09/2014 1. DOEL

Procedure PR01-1/5. Raad van Bestuur Documentenbeheer Datum: 15/09/2014 1. DOEL PR01-1/5 1. DOEL Deze procedure beschrijft hoe de kwaliteitsdocumenten worden beheerd. Hieronder wordt o.a. verstaan de werkwijzen die gevolgd worden bij het tot stand komen, wijzigen, bewaren en vrijgeven

Nadere informatie

6.4 DIRECTIEBEOORDELING

6.4 DIRECTIEBEOORDELING Pagina: van 7. DOEL PROCES Het systematisch beoordelen van de prestaties van de processen van HEWI Beheer B.V., waarbij gestreefd wordt naar het verkrijgen van gegevens voor prestatieverbetering van onze

Nadere informatie

Werken met de Systeemmanager Resultaatgericht leren werken met het INK-managementmodel

Werken met de Systeemmanager Resultaatgericht leren werken met het INK-managementmodel XQ Systeemmanagement XQ KIDS XQ TEAMS XQ MANAGEMEMT DIENSTVERLENING Voorlichting Advisering Training Begeleiding Coaching (Gebruikers) Netwerken Kwaliteitskringen Werken met de Systeemmanager Resultaatgericht

Nadere informatie

Facit-Kwaliteitsbingo Mogen uw medewerkers ook meedoen?

Facit-Kwaliteitsbingo Mogen uw medewerkers ook meedoen? Facit-Kwaliteitsbingo Mogen uw medewerkers ook meedoen? Tips: Noem bij het oplezen van de vragen niet het vraagnummer, de oplettende speler zal snel ontdekken dat deze ook op het bingo-formulier staan.

Nadere informatie

7.d. Uitvoeren van kwaliteitsaudits

7.d. Uitvoeren van kwaliteitsaudits Normblad bodembeheer 8002 Beheersing, controle en Pagina 1 van 4 7.d. Uitvoeren van kwaliteitsaudits Doelstelling Een interne audit is een belangrijk instrument om: a. het kwaliteitssysteem in zijn geheel

Nadere informatie

IKZ - Cel. Vanuit het Isomorphosis-idee van sandwichvergaderingen ontstaan de vaste IKZ-celvergaderingen:

IKZ - Cel. Vanuit het Isomorphosis-idee van sandwichvergaderingen ontstaan de vaste IKZ-celvergaderingen: VOORZITTER: IKZ - Cel O 7.3 campusdirecteur i.s.m. pedagogisch directeur VASTE LEDEN, nadien IKZ-coördinatoren: 2005 2006: directieleden UM-HAG 2006 2007: idem + opleiding graadcoördinatoren en vertegenwoordigers

Nadere informatie

ALGEMENE' VOORWAARDEN'

ALGEMENE' VOORWAARDEN' ALGEMENE' VOORWAARDEN' Elly'Degen,'mediavormgeving' KvK:63785196 BTW:NL21.95.68.704B01 Dezealgemenevoorwaardenzijnvantoepassingopdetotstandkoming,de inhoudendenakomingenvanalletussendeopdrachtgeverenellydegen

Nadere informatie

Kwaliteithandboek ISO-9001. Kwaliteitshandboek. van. Volgens

Kwaliteithandboek ISO-9001. Kwaliteitshandboek. van. Volgens Kwaliteitshandboek van Volgens NEN-ISO-9001:2008 Colofon: Dit kwaliteitshandboek is eigendom van: De Betho Scottweg 4 4462 GS Goes. Tel: 0113-233933. Fax: 0113-233444. Dit kwaliteitshandboek is samengesteld

Nadere informatie

De AO en procesmanagement

De AO en procesmanagement De AO en procesmanagement Theorie en voorbeelden van de AO en procesmanagement Door : Gert van Hardeveld Datum : 29 augustus 2012 Versie : 3.0 INHOUD PAGINA 1 INLEIDING... 3 2 WAAROM ORGANISATIES PROCESSEN

Nadere informatie

FPC01 Overzichtsplan kwaliteitshandboek & documenten Conform EN1090-2 en EN ISO 3834-2

FPC01 Overzichtsplan kwaliteitshandboek & documenten Conform EN1090-2 en EN ISO 3834-2 FPC01 Overzichtsplan kwaliteitshandboek & documenten Conform EN1090-2 en EN ISO 3834-2 Alle documenten die hieronder vermeld staan vormen samen het kwaliteitshandboek. Dit document toont beknopt hoe, waar

Nadere informatie

Service van begin tot eind. De kwaliteit en service van Business Volume Service (BVS)

Service van begin tot eind. De kwaliteit en service van Business Volume Service (BVS) Service van begin tot eind De kwaliteit en service van Business Volume Service (BVS) INHOUD 1 VOORWOORD 2 MISSIE BVS 3 KWALITEITSBELEID 4 ORGANISATIESTRUCTUUR 5 HET KWALITEITSSYSTEEM 5.1 NORMEN 5.2 ELEMENTEN

Nadere informatie

PRAKTISCHE RICHTLIJNEN BIJ HET INVOEREN VAN KLINISCHE AUDITS IN DE NUCLEAIRE GENEESKUNDE

PRAKTISCHE RICHTLIJNEN BIJ HET INVOEREN VAN KLINISCHE AUDITS IN DE NUCLEAIRE GENEESKUNDE PRAKTISCHE RICHTLIJNEN BIJ HET INVOEREN VAN KLINISCHE AUDITS IN DE NUCLEAIRE GENEESKUNDE 1. INLEIDING De klinische audits (KA) werden ingevoerd in de Belgische diensten Radiotherapie in 2007, Nucleaire

Nadere informatie

Beheer van niet-conformiteiten, preventieve acties en externe klachten. Inhoudstafel

Beheer van niet-conformiteiten, preventieve acties en externe klachten. Inhoudstafel P. : 1/5 Opsteller: AM Vanherle Verificateur :P. Cliquet, C.Graide Vertaler : AM Vanherle Goedkeuring Naam Functie Handtekening Datum Goedgekeurd door : H. Van Oyen Operationele directeur 29/08/2012 Inhoudstafel

Nadere informatie

Deelplan IC Investeringen en kredieten 2014. Gemeente Lingewaard

Deelplan IC Investeringen en kredieten 2014. Gemeente Lingewaard Deelplan IC Investeringen en kredieten 2014 Gemeente Lingewaard Inhoudsopgave 1. Aanleiding 2 2. Structureel / incidenteel 2 3. Opdrachtgever 2 4. Opdrachtnemer 2 5. Relevante wet- en regelgeving 2 6.

Nadere informatie

Beloofd is beloofd. Beschrijving van het kwaliteitsmanagementsysteem van KPC Groep

Beloofd is beloofd. Beschrijving van het kwaliteitsmanagementsysteem van KPC Groep Beloofd is beloofd Beschrijving van het kwaliteitsmanagementsysteem van KPC Groep INHOUD 1 VOORWOORD 2 MISSION KPC GROEP 3 KWALITEITSBELEID 4 ORGANISATIESTRUCTUUR 4.1 Organogram 4.2 Processchema 5 HET

Nadere informatie

Standard Operating Procedure

Standard Operating Procedure Standard Operating Procedure STZ SOP: O3 Ontwikkelen, implementeren en beheren van SOP s Distributielijst : STZ Datum : 15-10-2012 Revisiedatum : 15-10-2013 Veranderingen ten opzichte van eerdere versies

Nadere informatie

Belangrijke wijzigingen HKZ-normen

Belangrijke wijzigingen HKZ-normen Belangrijke wijzigingen HKZ-normen door wijzigingen in ISO 9001:2015 Belangrijke wijzigingen HKZ-normen Op 15 september 2015 is de nieuwe ISO 9001:2015 gepubliceerd. Een groot aantal HKZ-normen is ISO-compatibel.

Nadere informatie

RICHTSNOEREN OVER DE REGLEMENTAIRE WERKZAAMHEDEN VAN DE CCR. Artikel 1. Doel en strekking van het besluit

RICHTSNOEREN OVER DE REGLEMENTAIRE WERKZAAMHEDEN VAN DE CCR. Artikel 1. Doel en strekking van het besluit CENTRALE COMMISSIE VOOR DE RIJNVAART Bijlage bij RV (12) 45 add. 1 RICHTSNOEREN OVER DE REGLEMENTAIRE WERKZAAMHEDEN VAN DE CCR Artikel 1 Doel en strekking van het besluit 1. Dit besluit bepaalt de manier

Nadere informatie

Handboek REOB. Voorneveld Brandbeveiliging BV en Tempo Brandbeveiliging, in deze teksten verder te noemen VBL

Handboek REOB. Voorneveld Brandbeveiliging BV en Tempo Brandbeveiliging, in deze teksten verder te noemen VBL :Voorneveld Brandbeveiliging BV :Tempo Brandbeveiliging : Kastanjelaan 20 : Loosdrecht : 0355823452* : info@tempoholland.nl : http://www.tempoholland.nl Voorneveld Brandbeveiliging BV en Tempo Brandbeveiliging,

Nadere informatie

Facit-Kwaliteitsbingo Mogen uw medewerkers ook meedoen?

Facit-Kwaliteitsbingo Mogen uw medewerkers ook meedoen? Facit-Kwaliteitsbingo Mogen uw medewerkers ook meedoen? Tips: Noem bij het oplezen van de vragen niet het vraagnummer, de oplettende speler zal snel ontdekken dat deze ook op het bingo-formulier staan.

Nadere informatie

Deelplan IC Memoriaalboekingen 2014. Gemeente Lingewaard

Deelplan IC Memoriaalboekingen 2014. Gemeente Lingewaard Deelplan IC Memoriaalboekingen 2014 Gemeente Lingewaard Inhoudsopgave 1. Aanleiding 2 2. Structureel / incidenteel 2 3. Opdrachtgever 2 4. Opdrachtnemer 2 5. Relevante wet- en regelgeving 2 6. Rapportage

Nadere informatie

F1-Auditrapport versie080505 Pagina 1 van 5. Inspectie gehandicaptenzorg ISO 9001: 2000 gecertificeerd AUDITRAPPORT

F1-Auditrapport versie080505 Pagina 1 van 5. Inspectie gehandicaptenzorg ISO 9001: 2000 gecertificeerd AUDITRAPPORT F1-Auditrapport versie080505 Pagina 1 van 5 Inspectie gehandicaptenzorg ISO 9001: 2000 gecertificeerd AUDITRAPPORT Voorziening: Nummer: Adres: e-mail adres website Erkenning: Huis in de stad Z107 A099

Nadere informatie

Hermann-Otto F. Israël HBO werk- en denkniveau 31 mei 1967 Oosterhout (NB) In bezit van rijbewijs B

Hermann-Otto F. Israël HBO werk- en denkniveau 31 mei 1967 Oosterhout (NB) In bezit van rijbewijs B Persoonlijke informatie Hermann-Otto F. Israël HBO werk- en denkniveau 31 mei 1967 Oosterhout (NB) In bezit van rijbewijs B Talenkennis Nederlands (moedertaal), vloeiend in woord en geschrift Engels, vloeiend

Nadere informatie

Kwaliteitshandboek 4. Kwaliteitssysteem 4.6. Overzicht van de procedures 4.6.14. Het plannen en implementeren van kwaliteitsaudits

Kwaliteitshandboek 4. Kwaliteitssysteem 4.6. Overzicht van de procedures 4.6.14. Het plannen en implementeren van kwaliteitsaudits Pagina 1 van 5 Beoordeeld: Goedgekeurd: Geldig vanaf: Documenteigenaar: kwaliteitscoördinator Doel - Bepalen of de activiteiten op het gebied van kwaliteit en de daarmee samenhangende resultaten (=realiteit)

Nadere informatie

ISO 9001:2000 en EFQM bij AOSO Marc Gernaey

ISO 9001:2000 en EFQM bij AOSO Marc Gernaey INFOSHOP ISO 9001:2000 en EFQM bij AOSO Marc Gernaey 1 Doelstelling Implementatie van ISO 9001:2000 bij een overheidsadministratie ISO 9001 en AOSO Doelstelling van AOSO Filosofie en uitgangspunten van

Nadere informatie

Procesbeschrijving, hoe doe k dat nou? Kennisdeling procesmanagement 28 november 2011

Procesbeschrijving, hoe doe k dat nou? Kennisdeling procesmanagement 28 november 2011 Procesbeschrijving, hoe doe k dat nou? Kennisdeling procesmanagement 28 november 2011 1 Procesbeschrijving, hoe doe k dat nou? Aanleiding: Reorganisatie: meer met minder. Geen nieuwe software, maar bestaande

Nadere informatie

KRIZ: Kwaliteitsrichtlijn voor Infectiepreventie in Ziekenhuizen. BIJLAGE 4 CHECKLIST (QUICKSCAN) versie 2.0

KRIZ: Kwaliteitsrichtlijn voor Infectiepreventie in Ziekenhuizen. BIJLAGE 4 CHECKLIST (QUICKSCAN) versie 2.0 BIJLAGE 4: CHECKLIST (QUICKSCAN) 1. VISIE EN MISSIE aantoonbare, vastgelegde visie / missie van zowel afdeling als evt. organisatie geen discrepantie tussen visie / missie van afdeling resp. organisatie

Nadere informatie

Wat certificatie voor u betekent. www.kbi.nl www.sikb.nl

Wat certificatie voor u betekent. www.kbi.nl www.sikb.nl Wat certificatie voor u betekent www.kbi.nl www.sikb.nl Arthur de Groof & Wil van Ophem Dordrecht & Amersfoort, 26 & 28 november 2013 Presentatie vandaag Ontwikkeling Regeling bodemkwaliteit en ondersteunende

Nadere informatie

Aanleiding onderzoek archivering WABO-dossiers

Aanleiding onderzoek archivering WABO-dossiers Aanleiding onderzoek archivering WABO-dossiers Algemeen De omgevingsdiensten voeren taken uit op het gebied van Wabo namens de provincie en de gemeenten in hun werkgebied. Welke taken dat zijn, is per

Nadere informatie

Vlaams ministerie MOW. Checklist nr. 1. goedkeuringsdatum, het afdelingshoofd. de kwaliteitsverantwoordelijke. ir. J. J. Polen. Ing. D.

Vlaams ministerie MOW. Checklist nr. 1. goedkeuringsdatum, het afdelingshoofd. de kwaliteitsverantwoordelijke. ir. J. J. Polen. Ing. D. afdeling Betonstructuren - Gent Procedure 7.7 blz. 1 van 10 Checklist nr. 1 Beoordeling van het kwaliteitssysteem aan de hand van het kwaliteitshandboek eis ja neen opmerkingen 1 Juridische structuur van

Nadere informatie

Documenteigenaar Adviseur SHEQ Revisie 20-05-15. Proceseigenaar Manager SHEQ Pagina: 1 van 7

Documenteigenaar Adviseur SHEQ Revisie 20-05-15. Proceseigenaar Manager SHEQ Pagina: 1 van 7 Proceseigenaar Manager SHEQ Pagina: 1 van 7 0. Versiebeheer Onderstaand worden de wijzigingen t.o.v. de vorige goedgekeurde versie beschreven. Nr. 1 2 3 Wijziging(en) TA wordt minimaal 2 werkdagen voor

Nadere informatie

veel gestelde vragen en antwoorden

veel gestelde vragen en antwoorden Uw openbare apotheek certificeren: veel gestelde vragen en antwoorden Wat zijn de voordelen? Hoe werkt certificering via DEKRA? Ik wil me laten certificeren. Aan welke eisen moet ik voldoen? Hoe kan ik

Nadere informatie

VEREISTEN VOOR EEN KWALITEITS-

VEREISTEN VOOR EEN KWALITEITS- INFRABEL N.V. TECHNISCHE BEPALING A - 52 QP VEREISTEN VOOR EEN KWALITEITS- EN CONTROLEPLAN BIJ INFRABEL EDITIE : 10/2006 Inhoudstabel. Inhoudstabel...2 1. Onderwerp...3 2. Toepassingsdomein...3 3. Definities...3

Nadere informatie

Kwaliteitshandboek Hobéon

Kwaliteitshandboek Hobéon Kwaliteitshandboek Hobéon Lange Voorhout 14 2514 ED Den Haag T (070) 30 66 800 F (070) 30 66 870 I www.hobeon.nl E info@hobeon.nl Kwaliteitshandboek Hobéon Hobéon Datum: 20 augustus 2013 Auteurs: Paul

Nadere informatie

Kwaliteitshandboek Hobéon

Kwaliteitshandboek Hobéon Kwaliteitshandboek Hobéon Lange Voorhout 14 2514 ED Den Haag T (070) 30 66 800 F (070) 30 66 870 I www.hobeon.nl E info@hobeon.nl Kwaliteitshandboek Hobéon Hobéon Datum: 23 september 2014 Auteurs: Paul

Nadere informatie

Een kwaliteitshandboek voor de juridische bibliotheek

Een kwaliteitshandboek voor de juridische bibliotheek Een kwaliteitshandboek voor de juridische bibliotheek Wat is het nut van een kwaliteitshandboek? Gezien door de bril van de bibliothecaris Een praktisch instrument om processen en kwaliteit van eigen bibliotheek

Nadere informatie

1 Wat zijn interne audits?

1 Wat zijn interne audits? 1 Wat zijn interne audits? Binnen de organisatie willen we kwaliteit garanderen in de zorgverlening die wij bieden of het product dat we maken. We hebben daarom allerlei afspraken gemaakt over het werk.

Nadere informatie

Titel: Vaststelling uitslag Nummer: 4.00 Versie: 0.1 Datum: 27 april 2008

Titel: Vaststelling uitslag Nummer: 4.00 Versie: 0.1 Datum: 27 april 2008 Titel: Vaststelling uitslag Nummer: 4.00 Datum: 27 april 2008 Titel: Publiceren Performed votes Nummer: 4.01 Datum: 24 april 2008 Doel Het publiceren van een bestand met alle uitgebrachte stemmen. Toepassing

Nadere informatie

Deelplan IC Treasury 2014. Gemeente Lingewaard

Deelplan IC Treasury 2014. Gemeente Lingewaard Deelplan IC Treasury 2014 Gemeente Lingewaard 1 Inhoudsopgave 1. Aanleiding 3 2. Structureel / incidenteel 3 3. Opdrachtgever 3 4. Opdrachtnemer 3 5. Relevante wet- en regelgeving 3 6. Rapportage 4 7.

Nadere informatie

B-QUANUM. Kwaliteitsmanagement in de nucleaire geneeskunde Interne audit volgens B-QUANUM

B-QUANUM. Kwaliteitsmanagement in de nucleaire geneeskunde Interne audit volgens B-QUANUM B-QUANUM Kwaliteitsmanagement in de nucleaire geneeskunde Interne audit volgens B-QUANUM JACQUES RUTTEN 27 JUNI 2012 Het nut van kwaliteitsmanagement in de NG Incidentmeldingen de rol van de kwaliteitscoördinator

Nadere informatie

Norm voor Central Filling. Vastgesteld tijdens de vergadering van het Hoofdbestuur van de KNMP op 28 april 2010 te Den Haag.

Norm voor Central Filling. Vastgesteld tijdens de vergadering van het Hoofdbestuur van de KNMP op 28 april 2010 te Den Haag. Norm voor Central Filling Vastgesteld tijdens de vergadering van het Hoofdbestuur van de KNMP op 28 april 2010 te Den Haag. Inleiding Voor u ligt de norm voor apotheken die werken met central filling voor

Nadere informatie

Kwaliteit in kleine en middelgrote zorginstellingen

Kwaliteit in kleine en middelgrote zorginstellingen Kwaliteit in kleine en middelgrote zorginstellingen PART zorg - Masterclass februari 2013 Agenda 1 2 3 4 5 6 7 8 Kennismaking + huiswerkopdracht Wat is kwaliteit? Kwaliteitscertificaten Uit het nieuws

Nadere informatie

KWALITEITSHANDBOEK AFDELING BODEMSANERING ISO 9001:2000. Versie 1.0. Provinciehuis Zuid-Hollandplein 1 Postbus 90602 2509 LP Den Haag

KWALITEITSHANDBOEK AFDELING BODEMSANERING ISO 9001:2000. Versie 1.0. Provinciehuis Zuid-Hollandplein 1 Postbus 90602 2509 LP Den Haag KWALITEITSHANDBOEK AFDELING BODEMSANERING ISO 9001:2000 Versie 1.0 Provinciehuis Zuid-Hollandplein 1 Postbus 90602 2509 LP Den Haag Tel: 070-4416585 Fax: 070-4417804 Alle rechten zijn uitdrukkelijk voorbehouden

Nadere informatie

LIJ08: overzichtlijst EN1090 documenten

LIJ08: overzichtlijst EN1090 documenten FPC 1 B Kwaliteitshandboek & documenten: Conform EN100-2 (EXC2) en EN ISO 3834-3" Fabriekbeheersingsysteem (FPC) - KwaliteitsHandBoek (KHB) 1 PRO 1 B Taken en verantwoordelijkheden lascoördinator Procedures

Nadere informatie

Kwaliteitshandboek Hobéon

Kwaliteitshandboek Hobéon Kwaliteitshandboek Hobéon Lange Voorhout 14 2514 ED Den Haag T (070) 30 66 800 F (070) 30 66 870 I www.hobeon.nl E info@hobeon.nl Kwaliteitshandboek Hobéon Hobéon Datum: 04-12-2015 Auteurs: Paul van Embden

Nadere informatie

Deelplan IC Grondexploitaties 2014. Gemeente Lingewaard

Deelplan IC Grondexploitaties 2014. Gemeente Lingewaard Deelplan IC Grondexploitaties 2014 Gemeente Lingewaard 0 Inhoudsopgave 1. Aanleiding 2 2. Structureel / incidenteel 2 3. Opdrachtgever 2 4. Opdrachtnemer 2 5. Relevante wet- en regelgeving 2 6. Rapportage

Nadere informatie

2. Toepassingsgebied Klachten van de gebruiker m.b.t. de hulp- en dienstverlening, die gemeld worden aan een medewerker van De Meander.

2. Toepassingsgebied Klachten van de gebruiker m.b.t. de hulp- en dienstverlening, die gemeld worden aan een medewerker van De Meander. 1/5 Beoordeeld: Stuurgroep Kwaliteit Geldig vanaf: 26/06/2013 Procedurehouder: Sociale dienst Goedgekeurd: Luc Lemkens Paraaf: 1. Termen en definities Interne klachtencommissie: De klachtencommissie bestaat

Nadere informatie

Inleiding en uitgangspunten

Inleiding en uitgangspunten Inleiding en uitgangspunten Deze DVO (Dienstverleningsovereenkomst) moet zorgen voor een goede afstemming tussen de betrokken partijen over het niveau van de dienstverlening en de hierbij te leveren prestaties.

Nadere informatie

DEMO en Financiële dienstverlening

DEMO en Financiële dienstverlening DEMO en Financiële dienstverlening Richard Schoones 28-9-2012 1 Wie ben ik? Ruim 30 jaar actief binnen Financiële dienstverlening Ondernemer Als zelfstandig intermediair & gevolmachtigde Directie van Lanschot

Nadere informatie

Klachtenregeling. To The Point Expertise BV

Klachtenregeling. To The Point Expertise BV Klachtenregeling To The Point Expertise BV 1 INHOUDSOPGAVE Artikel 1 Begripsbepalingen 3 Artikel 2 Samenstelling van de klachtencommissie 4 Artikel 3 Indiening van een klacht 4 Artikel 4 Doelstelling klachtenregeling

Nadere informatie

Google Applicaties Online samenwerken. Paul Diliën ICT integratie 2012. Vlaams Verbond van het Katholiek Secundair Onderwijs

Google Applicaties Online samenwerken. Paul Diliën ICT integratie 2012. Vlaams Verbond van het Katholiek Secundair Onderwijs Google Applicaties Online samenwerken Paul Diliën ICT integratie 2012 Vlaams Verbond van het Katholiek Secundair Onderwijs Guimardstraat 1, 1040 Brussel Vlaams Verbond van het Katholiek Secundair Onderwijs

Nadere informatie

HANDLEIDING IMPLEMENTATIE PARTOS 9001

HANDLEIDING IMPLEMENTATIE PARTOS 9001 2012 Bijlage 2 bij 120424/alv/5 HANDLEIDING IMPLEMENTATIE PARTOS 9001 Versie 0.87 02-02-2012 Inhoud 1 Inleiding... 3 2 Begrippenlijst... 4 2.1 Waarom een kwaliteitsmanagementsysteem?... 6 2.2 Waarom zou

Nadere informatie

Page 1 of 14. Deel 1: Procedures 1. Algemeen. Milieuhandboek Versie 1.0 1 april 2014. Page 1 of 14. 1.1.1: Inhoud en structuur handboek

Page 1 of 14. Deel 1: Procedures 1. Algemeen. Milieuhandboek Versie 1.0 1 april 2014. Page 1 of 14. 1.1.1: Inhoud en structuur handboek Milieu Page 1 of 14 Versie beheer Versie no. Datum Wijzigingen Auteur(s) 001 13-06-2014 H. Luksen Page 1 of 14 Milieu Page 2 of 14 Inhoud 0. MANAGEMENTVERKLARING 4 1. DOEL, INHOUD, STRUCTUUR MILIEUMANAGEMENTSYSTEEM

Nadere informatie

De transfusieketen: alle schakels OK!, maar wie bewaakt de keten? Martin Schipperus, internist- hematoloog HagaZiekenhuis Den Haag

De transfusieketen: alle schakels OK!, maar wie bewaakt de keten? Martin Schipperus, internist- hematoloog HagaZiekenhuis Den Haag De transfusieketen: alle schakels OK!, maar wie bewaakt de keten? Martin Schipperus, internist- hematoloog HagaZiekenhuis Den Haag Stappen in de transfusieketen l e v e r a n c i e r medewerkers ziekenhuislaboratorium

Nadere informatie

Best practice Omring. Memo en protocol

Best practice Omring. Memo en protocol Best practice Omring Memo en protocol Doelen: Memo: voorstel aan het managementteam mbt implementatie meldcode Protocol: informeren werknemers over de werkwijze, de te volgen stappen bij signalen van huiselijk

Nadere informatie

Hoppas Kinderopvang. Rijswijk NB

Hoppas Kinderopvang. Rijswijk NB organisatie advies arbodienstverlening opleidingen & trainingen personeelsdiensten Eindverslag Rapport Interne Audit Hoppas Kinderopvang te Rijswijk NB Uitgevoerd voor: Uitgevoerd door: Hoppas Kinderopvang

Nadere informatie

VEBIT Keuringsrichtlijn 2012 Versie 1.0.4_4. Vastgesteld door het VEBIT-bestuur op 21 juni 2011

VEBIT Keuringsrichtlijn 2012 Versie 1.0.4_4. Vastgesteld door het VEBIT-bestuur op 21 juni 2011 VEBIT Keuringsrichtlijn 2012 Versie 1.0.4_4 Vastgesteld door het VEBIT-bestuur op 21 juni 2011 Aangepast op 26-9-2012: Directieverklaring mag niet ouder zijn dan 3 jaar. In versie 1.0.4.-3 was dit 1 jaar,

Nadere informatie

Dragon1 EA Tool. Business case webbased EA tool. Een webbased EA tool geschikt voor elke architectuurmethode!

Dragon1 EA Tool. Business case webbased EA tool. Een webbased EA tool geschikt voor elke architectuurmethode! Dragon1 EA Tool Business case webbased EA tool Een webbased EA tool geschikt voor elke architectuurmethode! uw organisatie, datum, versie #.#, documentstatus eigenaar/budgetverantwoordelijke: Kies op deze

Nadere informatie

ONDERWIJSKWALITEIT NASTREVEN UITGAANDE VAN ISO 9001 MOGELIJK OF ONREALISTISCH?

ONDERWIJSKWALITEIT NASTREVEN UITGAANDE VAN ISO 9001 MOGELIJK OF ONREALISTISCH? ONDERWIJSKWALITEIT NASTREVEN UITGAANDE VAN ISO 9001 MOGELIJK OF ONREALISTISCH? Dag van de kwaliteitszorg 10 juni 2011 Rik Delmotte De spreker Traject doorlopen in het onderwijs: leraar elektriciteit-elektronica,

Nadere informatie

Opstapcertificatie fase I en II > VV&T Onderdeel Kraamzorg

Opstapcertificatie fase I en II > VV&T Onderdeel Kraamzorg Opstapcertificatie fase I en II > VV&T Onderdeel Kraamzorg Versie 2012 Inleiding 201 Nederlands Normalisatie Instituut. Niets uit deze uitgave mag worden vermenigvuldigd en/of openbaar gemaakt door middel

Nadere informatie

Bedrijfsdienst. Agenda: Voorstellen Leeuwenborgh ICT Risk management Voorbeeld

Bedrijfsdienst. Agenda: Voorstellen Leeuwenborgh ICT Risk management Voorbeeld 1 Riskmanagement 2 Bedrijfsdienst Agenda: Voorstellen Leeuwenborgh ICT Voorbeeld 3 Bedrijfsdienst Applicaties Leeuwenborgh breed, vaak beheerd door ICT BD-ICT Staat centraal in het gestructureerd beheren

Nadere informatie

Interne audittraining

Interne audittraining Interne audittraining door Annette Thijssen 100311 Interne Audittraining.doc Pagina 1 van 20 Wat is een interne audit Een systematische en onafhankelijke beoordeling met als doel: Nagaan of de procedures

Nadere informatie

Deze procedure beschrijft de wijze waarop klachten gerapporteerd, geregistreerd, afgehandeld en geanalyseerd worden.

Deze procedure beschrijft de wijze waarop klachten gerapporteerd, geregistreerd, afgehandeld en geanalyseerd worden. 1. Inleiding Een klacht kan om meer kwesties gaan dan het contact met de begeleider. Ook in de organisatie van het begeleidingstraject kan van alles misgaan. Het gaat om zaken die anders hadden moeten

Nadere informatie

Raadsvoorstel. Koers in het sociale domein. Maatschappelijke participatie kaderstelling Koers in het sociale domein

Raadsvoorstel. Koers in het sociale domein. Maatschappelijke participatie kaderstelling Koers in het sociale domein Titel Nummer 14/63 Datum 21 augustus 2014 Programma Fase Onderwerp Maatschappelijke participatie kaderstelling Gemeentehuis Bezoekadres Kerkbuurt 4, 1511 BD Oostzaan Postadres Postbus 20, 1530 AA Wormer

Nadere informatie

R = k 1 * k 2 * S. Risicomanagement. R = risico ( /j) k 1 = kans op een incident (j -1 ) k 2 = kans dat het incident leidt tot schade S = schade ( )

R = k 1 * k 2 * S. Risicomanagement. R = risico ( /j) k 1 = kans op een incident (j -1 ) k 2 = kans dat het incident leidt tot schade S = schade ( ) Inhoud 1. Aanleiding 2. PRS methode + validatie 3. PRS formulier * demonstratie * 4. PRIMA aanpak * demonstratie * 5. SAFER procedure 6. Resultaten tot op heden 7. Borging Risicomanagement R = k 1 * k

Nadere informatie

Opvallende zaken uit onze uitgevoerde medewerkerstevredenheidsonderzoeken

Opvallende zaken uit onze uitgevoerde medewerkerstevredenheidsonderzoeken Opvallende zaken uit onze uitgevoerde medewerkerstevredenheidsonderzoeken Zoals u wellicht weet voert Walvis regelmatig onderzoeken uit naar de waardering en beleving van medewerkers binnen organisaties.

Nadere informatie

Compleet ISO 9001:2015 certificeringspakket

Compleet ISO 9001:2015 certificeringspakket Compleet ISO 9001:2015 certificeringspakket Snel, makkelijk en goed! Juni 2015 Beste (toekomstige) kwaliteitsmanager, Bent u op zoek naar een betaalbaar en goed kwaliteitssysteem? Dan is het basispakket

Nadere informatie

Integratie van content- en document management voor een betere informatieuitwisseling binnen en buiten uw organisatie.

Integratie van content- en document management voor een betere informatieuitwisseling binnen en buiten uw organisatie. OpenSesame ICT NIN Seminar : e-content 2007 Integratie van content- en document management voor een betere informatieuitwisseling binnen en buiten uw organisatie. 13 september 2007 Nico de Vries Eric van

Nadere informatie

MVIE Geluidssystemen B.V.

MVIE Geluidssystemen B.V. MILIEUZORGSYSTEEM van MVIE Geluidssystemen B.V. tevens handelend onder: MVIE Audiovisuele Techniek MVIE Home Entertainment De scope van dit kwaliteitssysteem is: MVIE levert, installeert en onderhoud professionele

Nadere informatie

INTEGRATIE VAN MANAGEMENTSYSTEMEN. Leen Scheers Senior consultant

INTEGRATIE VAN MANAGEMENTSYSTEMEN. Leen Scheers Senior consultant Welkom INTEGRATIE VAN MANAGEMENTSYSTEMEN Leen Scheers Senior consultant GEGEVEN bedrijven wensen verschillende managementsystemen met certificaten meerdere invalshoeken (KVM), zowel op managementniveau

Nadere informatie

2 Specificatie In deze tabel staat voor welk crebotraject de leereenheid is gemaakt Crebotraject code: 95323

2 Specificatie In deze tabel staat voor welk crebotraject de leereenheid is gemaakt Crebotraject code: 95323 LEEREENHEID ALA 1 Beheert Dit document bestaat uit twee onderdelen - Onderdeel Leereenheid - Onderdeel Onderwijsproduct 1 Naam leereenheid In deze tabel staat de naam en het type van de leereenheid Leereenheid

Nadere informatie

Documenteigenaar Adviseur SHEQ Revisie 09-09-15. Proceseigenaar Manager SHEQ Pagina: 1 van 5

Documenteigenaar Adviseur SHEQ Revisie 09-09-15. Proceseigenaar Manager SHEQ Pagina: 1 van 5 Proceseigenaar Manager SHEQ Pagina: 1 van 5 0. Versiebeheer Onderstaand worden de wijzigingen t.o.v. de vorige goedgekeurde versie beschreven. Nr. Wijziging(en) 1 Nieuwe huisstijl toegepast. 1. Doelstelling

Nadere informatie

Met cliënt wordt bedoeld de cliënt zelf of diens (wettelijke) vertegenwoordiger. De regeling is ook bedoeld voor klachten van medewerkers.

Met cliënt wordt bedoeld de cliënt zelf of diens (wettelijke) vertegenwoordiger. De regeling is ook bedoeld voor klachten van medewerkers. Pagina: 1 van 5 Uitgifte datum : 15-04-2014 1. Inleiding Een klacht kan om meer kwesties gaan dan medische fouten. Ook in het contact met de hulpverlener of in de organisatie van de zorg kan van alles

Nadere informatie

De toepassing van het Zelf Evaluatie Veiligheid Instrument Gezondheidszorg

De toepassing van het Zelf Evaluatie Veiligheid Instrument Gezondheidszorg De toepassing van het Zelf Evaluatie Veiligheid Instrument Gezondheidszorg De hete aardappel niet doorschuiven maar verantwoordelijkheid delen 8-4-2011 1 Noodzaak VMS Structureel falend risicomanagement

Nadere informatie

CAO & Arbeidsvoorwaardenreglement. Twee soorten cao s

CAO & Arbeidsvoorwaardenreglement. Twee soorten cao s CAO & Arbeidsvoorwaardenreglement Een collectieve arbeidsovereenkomst (cao) is een schriftelijke overeenkomst waarin afspraken over arbeidsvoorwaarden zijn vastgelegd, bijvoorbeeld over loon, betaling

Nadere informatie

PRODUCTEN & DIENSTEN SEMZORG WEBSHOP KWALITEIT

PRODUCTEN & DIENSTEN SEMZORG WEBSHOP KWALITEIT PRODUCTEN & DIENSTEN SEMZORG WEBSHOP KWALITEIT 1 INHOUDSOPGAVE Over Semzorg 3 Producten. 4 Prijzen producten 6 Advies & ondersteuning. 8 Prijzen advies & ondersteuning. 9 Uitbesteding kwaliteit.... 11

Nadere informatie

RAPPORT JAARLIJKS ONDERZOEK BASISSCHOOL FLEVOPARK

RAPPORT JAARLIJKS ONDERZOEK BASISSCHOOL FLEVOPARK RAPPORT JAARLIJKS ONDERZOEK BASISSCHOOL FLEVOPARK School : Basisschool Flevopark Plaats : Amsterdam BRIN-nummer : 19CH Onderzoeksnummer : 71081 Datum schoolbezoek : 7 februari 2006 Datum vaststelling :

Nadere informatie

Visitatieprogramma huisartsen

Visitatieprogramma huisartsen Visitatieprogramma huisartsen Klachtenreglement Visitatie Bureau Visitatie Huisartsen 1 november 2015 1 Begripsomschrijvingen 1.1 Klacht Een klacht is: een schriftelijke uiting van ongenoegen over de geboden

Nadere informatie

Weefselvigilantieplatform in het VUmc

Weefselvigilantieplatform in het VUmc Weefselvigilantieplatform in het VUmc Angelika Dräger, PhD Hoofd Hematologie Laboratoria en weefselvigilantiecoördinator 28 november 2012 Hematologie Laboratoria VUmc BTD Hemostase Stamcellab Cleanroom

Nadere informatie

4-11-2013. pagina x van y 1. Onderwerp. Qubic Solutions. Ansur gebruikersdag 2013 30 oktober 2013. Vision meets Precision. Vision meets Precision

4-11-2013. pagina x van y 1. Onderwerp. Qubic Solutions. Ansur gebruikersdag 2013 30 oktober 2013. Vision meets Precision. Vision meets Precision Ansur gebruikersdag 2013 30 oktober 2013 1 Onderwerp Kwaliteitsborging Medische Technologie met Qbus en Ansur door: Hans Schop 2 Qubic Solutions Oplossingen in procesbeheer Qubic Solutions ontwikkelt vanuit

Nadere informatie

ARE methodiek Het ontwikkelen van Informatie Elementen

ARE methodiek Het ontwikkelen van Informatie Elementen ARE methodiek Het ontwikkelen van Informatie Elementen WI1: Het opstarten van het project Milestone 1 WI2: Ontwikkel een Vison WI3: Modelleer het Business Domain WI4: Creëer een Glossary WI7: Beheer wijzigingen

Nadere informatie

Inkoop- en aanbestedingsbeleid Waterschap Vallei & Eem 2012

Inkoop- en aanbestedingsbeleid Waterschap Vallei & Eem 2012 Inkoop- en aanbestedingsbeleid Waterschap Vallei & Eem 2012 Inhoudsopgave 1. INLEIDING... 3 2. DOEL VAN HET INKOOP- EN AANBESTEDINGSBELEID... 3 3. KADERS VAN INKOPEN EN AANBESTEDEN... 4 4. BEPALING AANBESTEDINGSPROCEDURE...

Nadere informatie

KWALITEITSHANDBOEK. afdeling Bodemsanering. ISO 9001:2000 versie 7.0. Provincie Zuid-Holland Zuid-Hollandplein i Postbus 90602 2509 LP Den Haag

KWALITEITSHANDBOEK. afdeling Bodemsanering. ISO 9001:2000 versie 7.0. Provincie Zuid-Holland Zuid-Hollandplein i Postbus 90602 2509 LP Den Haag KWALITEITSHANDBOEK afdeling Bodemsanering ISO 9001:2000 versie 7.0 Provincie Zuid-Holland Zuid-Hollandplein i Postbus 90602 2509 LP Den Haag T 070-441 71 62 F 070-441 78 04 Alle rechten zijn uitdrukkelijk

Nadere informatie

33.64P Ontruimen besloten ruimte

33.64P Ontruimen besloten ruimte Proceseigenaar Manager KAM Pagina: 1 van 5 0. Versiebeheer Onderstaand worden de wijzigingen t.o.v. de vorige goedgekeurde versie beschreven. Nr. Wijziging(en) 1 N.v.t., eerste versie. 1. Doelstelling

Nadere informatie