Hyperferritinemieën en ijzerstapelingsziekten: een klinisch algoritme

Maat: px
Weergave met pagina beginnen:

Download "Hyperferritinemieën en ijzerstapelingsziekten: een klinisch algoritme"

Transcriptie

1 Hyperferritinemieën en ijzerstapelingsziekten: een klinisch algoritme David Cassiman Dienst Leverziekten en Metabool Centrum, UZ Leuven Keywords: ferritin haemochromatosis HFE hepcidin ferroportin transferrin hyperferritinemia V1281N_2009 De normale ijzerhuishouding Het volwassen menselijk lichaam bevat normaal gemiddeld 3 tot 4g ijzer. De inactieve ijzervoorraad (1-2g) wordt opgeslagen als ferritine, in monocyten-macrofagen (lever, milt, beenmerg) en in de leverparenchymcellen (de hepatocyten). Het actief ijzer zit in het hemoglobine (2g), in ijzerbevattende intracellulaire eiwitten als myoglobine (400mg) en circuleert in het plasma, gebonden aan transferrine (3-7mg). Ijzer wordt normaal opgenomen uit de voeding in zijn gereduceerde ferro-vorm (Fe2+), volgens de noden. Vanuit de cellen kan het getransporteerd worden naar het plasmacompartiment via ferroportine, een ijzer-dragerproteïne. Ijzerverlies uit het lichaam verloopt via bloedverlies en via de natuurlijke turn-over van mucosa en epithelen (afschilferen van darmmucosa en huid), wat uiteraard aan een snelheid vergelijkbaar met de ijzeropname in de darm gebeurt (1). Een centrale rol in de ijzerhuishouding wordt gespeeld door het peptide hormoon hepcidine, dat geproduceerd wordt in de lever (zie verder: Het hepcidinemodel, hepcidine het ijzerhormoon). Teveel ijzer is niet goed Het ijzeratoom kan zeer gemakkelijk geoxideerd en gereduceerd worden. Die eigenschap is erg belangrijk voor de fysiologische rol van ijzer, bijvoorbeeld in de reactie van ijzer met zuurstof in hemoglobine, maar maakt ijzer tegelijk ook een erg gevaarlijk atoom. Het kan immers reageren met de omgeving en zo leiden tot de vorming van erg krachtige zuurstofradicalen (reactive oxygen species, ROS), zoals het superoxide anion, waterstofperoxide en het hydroxylradicaal. Wanneer er teveel vrij, reactief ijzer opstapelt in cellen en organen, kan dit leiden tot het ontstaan van enorme hoeveelheden ROS en uiteindelijk ernstige cel- en orgaanschade. Recent werd bijvoorbeeld duidelijk dat niet ijzerstapeling op zich, Hoe pak je in de dagelijkse praktijk een gestegen ferritine-waarde aan en wanneer moet je denken aan hemochromatose? Wat is de stand van zaken van de fundamenteelwetenschappelijke inzichten in de ijzerhuishouding en de daaraan verbonden aandoeningen? Hoe ga je te werk om de diagnose van hemochromatose te bevestigen, het subtype van ijzerstapelingsziekte te bepalen, de uitgebreidheid van de orgaanaantasting in kaart te brengen en uiteraard ook de patiënt (en de familie) te behandelen? Onderstaand overzichtsartikel probeert op al deze vragen een antwoord te bieden. maar wel de beschikbaarheid van reactief ijzer belangrijk is in de ontwikkeling van diabetes bij patiënten met hemochromatose (2). In het plasma zelf zal een overmaat aan ijzer leiden tot saturatie van de ijzertransporter transferrine en wanneer de transport-capaciteit gevuld is (transferrinesaturatie meer dan 75%), ontstaat er een voorraad vrij, labiel plasma-ijzer, dat ook in het plasma schade kan aanrichten. Teveel ijzer in het organisme is schadelijk. Zo is er bijvoorbeeld epidemiologisch een verband tussen de ijzerwaarden en het risico op ontwikkelen van allerhande kankers (3). Andersom is recent gebleken dat het uitvoeren van aderlatingen bij mensen zonder ijzerstapeling een beschermend effect heeft op het ontwikkelen van kanker (4). Interpretatie van ijzerwaarden in het bloed Om een goed beeld van de ijzerstatus van een patiënt te krijgen, worden best serumijzer, transferrine, transferrinesaturatie en serumferritine bepaald. Bij de interpretatie van deze ijzerwaarden zijn een aantal elementen onontbeerlijk. Ijzer wordt snel opgenomen uit de voeding, dus er zal bij patiënten een duidelijk verschil zijn in de ijzerwaarden wanneer ze gevast dan wel gevoed zijn op het moment van de bloedname. Vrouwen zullen, omdat ze tijdens hun reproductieve jaren systematisch bloed en dus ook ijzer verliezen, normaal lagere ijzerwaarden vertonen dan mannen. De normaalwaarden voor vrouwen zijn dus in principe lager dan die voor mannen. Daarnaast moeten we voor ogen houden dat ijzer opgeslagen zit in de lever en dat er daarom vals verhoogde waarden van ijzer en ferritine kunnen voorkomen wanneer er een actieve hepatitis en dus celuitval aanwezig is (gestegen transaminasen, m.n. AST en ALT). Alcoholmisbruik kan uiteraard leiden tot hepatitis, maar chronische blootstelling aan alcohol leidt op zich ook tot inductie van het ferritine en kan zo een beeld van ijzerstapeling nabootsen. Leversteatose of steatohepatitis in het kader van het metaboolsyndroom (overgewicht, insulineresistentie, hypertensie, hyperlipidemie) gaat vaak gepaard met verhoogde ferritinewaarden (tot 1.200µg/l) die niet noodzakelijk reële ijzerstapeling weerspiegelen maar eigen zijn aan het syndroom. De ijzertransporter transferrine is een zgn. negatief acuut-fase-eiwit en zal dus bij alle infectieuze of inflammatoire aandoeningen verlagen (Figuur 1). Wanneer het transferrine verlaagd is, zal de transferrinesaturatie vals verhoogd zijn, gezien de transferrinesaturatie de verhouding van ijzer t.o.v. transferrine weerspiegelt (100 x [serumijzerconcentratie / totale ijzerbindingscapaciteit] = transferrine saturatie). Ferritine daarentegen is een zgn. positief acuut-fase-eiwit en zal dus bij alle infectieuze, inflammatoire of maligne aandoeningen verhogen. Tenslotte is het belangrijk te weten dat sommige zeer

2 zeldzame aandoeningen gepaard kunnen gaan met een extreem hoog ferritine, namelijk o.a. het autosomaal-dominant hyperferritinemiekataraktsyndroom (veroorzaakt door mutaties in L-ferritine), het macrofagen-activatie-syndroom en de ziekte van Gaucher (een lysosomale stapelingsziekte). Samenvattend kunnen we stellen dat de ijzerparameters in het bloed enkel betrouwbaar geïnterpreteerd kunnen worden, wanneer de randvoorwaarden die boven geschetst werden, gecontroleerd zijn (er is geen hepatitis, geen leversteatose, geen alcoholmisbruik, geen inflammatoire aandoening, enz.). Wanneer een gestegen ferritine met of zonder gestegen transferrinesaturatie (Figuur 1) niet te herleiden zijn tot één van deze vals-positieve situaties, moet de mogelijkheid van een ijzerstapelingsziekte overwogen worden. Er bestaan verworven ijzerstapelingsziekten en aangeboren ijzerstapelingssyndromen. Het hepcidinemodel, hepcidine het ijzerhormoon Sinds een aantal jaren is het duidelijk dat hepcidine een peptidehormoon geproduceerd in de lever een centrale rol speelt in de ijzerhuishouding (5). Hepcidine wordt in de lever door hepatocyten gesynthetiseerd, onder invloed van de ijzerconcentraties in het bloed en de nood aan ijzer in o.a. het beenmerg. De aanmaak van hepcidine wordt geregeld door heel wat factoren, zoals o.a. het HFE-eiwit (zie verder, HFE-gerelateerde hemochromatose), hemojuveline, BMPs (bone morphogenetic proteins), transferrinereceptoren (5). Hepcidineconcentraties in het bloed zijn omgekeerd evenredig met de ijzerabsorptie in de darm en de mobilisatie van ijzer uit monocyten/ macrofagen. Wanneer de hepcidineconcentratie in het bloed laag is (Figuur 2a), wordt er meer ijzer opgenomen uit de voeding en meer ijzer gemobiliseerd uit monocyten/macrofagen en zal het ijzer in het bloed dus stijgen. Omgekeerd zal, wanneer hepcidine in het bloed hoog is (Figuur 2b), de opname van ijzer uit de voeding afnemen en het ijzer in de monocyten/macrofagen opgeslagen blijven. De manier waarop het hepcidine dit bewerkstelligt is nog niet helemaal duidelijk, maar het is geweten dat hepcidine bindt aan de ijzer-exporter ferroportin, die zich o.a. bevindt op de basolaterale (plasmatische) zijde van de enterocyten. Door de binding van hepcidine, wordt dit ferroportine geïnternaliseerd (Figuur 2b) in de cel en kan het geen ijzer meer uit de Figuur 1: Interpretatie van de ijzerparameters. cel in het plasma pompen. Het ijzer in de enterocyten gaat hierdoor oplopen, waardoor de opname van ijzer uit de voeding afneemt (feedback-inhibitie). Tf/TIBC = transferrine/total iron binding capacity. Fe = ijzerwaarde in serum. Normaal bedraagt de transferrinesaturatie ongeveer 30%. Bij de geschetste problemen (ferriprivie, chronische inflammatie en hemochromatose) veranderen de ijzerparameters zoals aangegeven in de figuur. Tf/TIBC Fe 30% Normaal Ferriprivie Chronische inflammatie Figuur 2: Het hepcidinemodel. Bovenste segment van de figuur is het lumen van de darm. Middenste segment zijn de enterocyten van het darmslijmvlies. Onderste segment is het bloedcompartiment. A. Wanneer er weinig hepcidine (gele balletjes) in het bloed aanwezig is, blijft het ferroportine (groene kanaal in de basolaterale membraan van de enterocyten) functioneel en open. Het ijzer (Fe2+, roestkleurige balletjes) dat opgenomen wordt uit de voeding via DMT1 (divalent metal transporter 1), zal gemakkelijk doorstromen van het cytoplasma van de enterocyt naar het bloedcompartiment. Hierdoor is de ijzeropname uit de voeding hoog en het ijzer in het bloed ook. Hemo-chromatose B. Wanneer er veel hepcidine in het bloed aanwezig is, gaat dit binden aan het ferroportine, zodat dit geïnternaliseerd wordt in de enterocyten. Ijzer dat opgenomen wordt uit de voeding, stapelt op in het cytoplasma, met als gevolg dat er weinig ijzer zal opgenomen worden in de enterocyten. Hierdoor is het ijzer in het bloed laag en de ijzeropname uit de voeding laag.

3 In geval van chronische inflammatie wordt hepcidine geïnduceerd. Er zal minder ijzer uit de voeding opgenomen worden en de ijzervoorraden in de lever en in monocyten/macrofagen zijn niet mobiliseerbaar. Hierdoor ontstaat in eerste instantie een functioneel ijzertekort en daarna een reëel ijzertekort en kan er een zgn. toxische anemie ontstaan (6). Verworven ijzerstapeling De verworven ijzerstapelingsziekten omvatten in hoofdzaak de aandoeningen die gepaard gaan met verhoogde gastrointestinale ijzerabsorptie en/of verhoogde exogene ijzertoediening, zoals chronische hemolytische anemieën, stoornissen van de vorming van de rode bloedcellen (dyserythropoiese, sideroblastische anemie, thalassemia major), chronische IV of IM ijzersubstitutie, repetitieve toediening van bloed of afgeleide producten. Om een verworven ijzerstapelingsziekte uit te sluiten, moeten het hemoglobine, het MCV (mean corpuscular volume), hemolyseparameters en de voorgeschiedenis van de patiënt (transfusies en IV/IM ijzersubstitutie) gekend zijn. Aangeboren ijzerstapeling Veruit de voornaamste aangeboren ijzerstapelingsziekte in dit deel van de wereld is type I-hemochromatose, de meest frequente autosomaal recessieve aandoening (1/200 aangetast, 1/10 is drager), veroorzaakt door mutaties in het HFE-gen. Ongeveer 95% van de aangeboren ijzerstapelingssyndromen wordt veroorzaakt door HFE-mutaties en dan nog in hoofdzaak door de typische C282Y-mutatie (5). Daarnaast bestaan er nog varianten, waarvan tot op heden niet helemaal duidelijk is of ze ziekteveroorzakend zijn, namelijk de H63D- en de S65C-varianten. Het HFE-eiwit bepaalt in de hepatocyten mee de productie van hepcidine. Als het HFE-eiwit niet normaal gevormd is door mutaties in het gen voor HFE zal de hepcidine concentratie in het bloed dalen, de ferroportinekanalen van de enterocyten worden niet geïnternaliseerd en staan open, ijzer stroomt vrij het lichaam binnen. Dit leidt op termijn tot ijzerstapeling met de typische klinische afwijkingen van hemochromatose (zie verder: HFE-gerelateerde hemochromatose: kliniek). Wanneer een aangeboren ijzerstapelingssyndroom niet te herleiden is tot HFE-mutaties en de betrokken patiënt jong tot zeer jong (minder dan 30 jaar) is, moet gedacht worden aan type II-hemochromatose, de juveniele hemochromatose, die in hoofdzaak zal presenteren met cardiale en endocriene problematiek en veroorzaakt kan worden door homozygote mutaties in het hemojuveniele gen (type IIa) of het hepcidinegen (type IIb). Veruit de voornaamste aangeboren ijzerstapelingsziekte in dit deel van de wereld is type I-hemochromatose. Wanneer een aangeboren ijzerstapelingssyndroom niet te herleiden is tot HFE-mutaties en de betrokken patiënt daarentegen van middelbare leeftijd is, wordt gedacht aan hemochromatose type III, veroorzaakt door mutaties in het transferrinereceptor-2-gen (6). Bij patiënten die niet voldoen aan de beschrijvingen hierboven en zeker wanneer er in de familie een autosomaal dominant overervingspatroon voorkomt, kan tenslotte gedacht worden aan een mutatie in het ferroportinegen. Er bestaan ferroportinemutaties die leiden tot inactiviteit van het ferroportine, dat ertoe leidt dat ijzer dat in monocyten/macrofagen opgenomen is, er niet meer uit raakt (hemochromatose type IVa, met ijzerstapeling in de cellen van het reticulo-endotheliaalstelsel van lever, milt en beenmerg) en er bestaan ferroportinemutaties die leiden tot overactiviteit van ferroportine, zodat het voedingsijzer via de enterocyten het lichaam ongehinderd binnenstroomt en gaat opstapelen in hepatocyten (hemochromatose type IVb). Er moet gescreend worden naar HFEgerelateerde hemochromatose bij nieuwe patiënten met diabetes mellitus. Daarnaast bestaan er een aantal aangeboren oorzaken van ijzerstapeling die zo zeldzaam zijn dat we er hier niet op ingaan, zoals aceruloplasminemie (6). diagnose Er moet aan de mogelijkheid van HFE-gerelateerde hemochromatose gedacht worden bij onverklaard gestoorde levertesten, hypogonadisme, abnormale huidpigmentatie, cardiomyopathie, arthritis en er moet gescreend worden naar HFE-gerelateerde hemochromatose bij nieuwe patiënten met diabetes mellitus. Een patiënt met HFE-gerelateerde hemochromatose vertoont in principe een verhoogd serumijzer (weinig sensitief of specifiek), een verhoogde transferrinesaturatie (met een normaal transferrine) en een verhoogd ferritine. Voor het ferritine worden geslachtsspecifieke normaalwaarden gebruikt. Voor de transferrinesaturatie wordt een waarde van 45% als cut-off gebruikt (richtlijnen van de American Association for the Study of the Liver, AASLD, van 2001) (7). Wanneer dit gepaard gaat met een (best meermaals aangetoond) gestegen ferritine, wordt overgegaan tot genetische screening. Bij de genetische screening wordt in principe eerst naar de aan- of afwezigheid van de typische C282Y-mutatie gezocht. Als deze mutatie homozygoot aanwezig is, is de diagnose gesteld. Als ze niet aanwezig is, is de diagnose van HFE-gerelateerde hemochromatose zeer onwaarschijnlijk. Als de C282Y-mutatie heterozygoot aanwezig is, wordt best verder gescreend naar de H63D- en S65C-mutaties die, wanneer ze samen met een C282Y-mutatie voorkomen, waarschijnlijk aanleiding kunnen geven tot tenminste de biochemische manifestaties van hemochromatose. Om bij een patiënt met diagnose van hemochromatose de status van orgaanschade op te maken, zijn een echo van de lever (argumenten voor cirrose en/of portale hypertensie?), een nuchtere glycemie en HbA1c, transaminasenbepaling en een testosteronspiegel (bij mannen) noodzakelijk. In bepaalde gevallen zijn een echocardiografie of gerichte radiologische onderzoeken van gewrichten aangewezen. Met een standaard MRI van de lever kunnen uiteraard aanwijzingen van de aan- of afwezigheid van cirrose, portale hypertensie en hepatocellulair carcinoma gevonden worden. Daarnaast laat de evaluatie van T2-gewogen beelden toe te bepalen of die ijzerstapeling zich vooral in de lever (m.n. hepatocytair bij type I, II, III, IVb) dan wel in lever, beenmerg en milt (dus reticuloendotheliaal: secundaire ijzerstapeling of type

4 Figuur 3: T2-gewogen MRI beelden van de buik bij primaire (links) vs. secundaire ijzerstapeling (rechts). Links: de densiteit van de lever is lager dan de densiteit van de paravertebrale spieren. De densiteit van de milt is niet verlaagd. Rechts: de densiteit van lever en milt zijn lager dan de densiteit van de paravertebrale spieren). Figuur 4: Leverbiopsies met Perl s ijzerkleuring. Links: ijzerstapeling in de hepatocyten muralia, met gradiënt van periportaal (rechts boven) naar centrolobulair (naar onder en naar links), typisch voor HFE-gerelateerde hemochromatose (en type II, type III en type IVb). Rechts: ijzerstapeling in de levermacrofagen (Kupffer cellen), typisch voor secundaire ijzerstapeling en type IVa. kliniek Naar schatting slechts 5 tot 50% van de C282Yhomozygoten gaan ziekteverschijnselen ontwikkelen. Met andere woorden, de penetrantie van het genotype C282Y/C282Y is variabel. Dit is het gevolg van omgevingsfactoren en aangeboren variaties (genetic modifiers). Wat betreft de omgevingsfactoren, is geweten dat groei, menstrueel bloedverlies, zwangerschap, bloedverlies, gebruik van protonpompinhibitoren de penetrantie van HFE-gerelateerde hemochromatose kunnen verlagen. Alcoholgebruik, thalassemie, leversteatose en steatohepatitis, virale hepatitis kunnen daarentegen de penetrantie verhogen. HFE-gerelateerde hemochromatose is dus een multifactoriële aandoening (9, 10). De kliniek van HFE-gerelateerde hemochromatose komt meestal pas tot uiting tussen 40- en 60-jarige leeftijd. Symptomatische ijzerstapeling is veel frequenter bij mannen dan bij vrouwen, door het maandelijks fysiologisch bloedverlies tijdens de menstruatie. Hemochromatose kan gepaard gaan met vermoeidheid, abnormale levertesten, cirrose, hepatocellulair carcinoma, cardiomyopathie (congestief hartfalen), hypogonadisme, hypothyreoïdie, impotentie, bronsverkleuring van de huid en arthropathie. Ongeveer 50% van de patiënten met HFE-gerelateerde hemochromatose heeft secundaire diabetes. De prognose van HFE-gerelateerde hemochromatose wordt bepaald door de aanwezigheid van cirrose, diabetes en hepatocellulair carcinoma. IVa) bevindt (6) (Figuur 3). Met nieuwe MRIsequenties (R2 relaxometrie), kan via MRI het ijzergehalte in de lever exact gemeten worden, wat definitieve bevestiging van ijzerstapeling geeft (beschikbaar in UZ Leuven) (8). De AASLD schrijft voor dat een leverbiopsie noodzakelijk is bij patiënten die een verhoogd risico hebben om cirrose ontwikkeld te hebben en dat zijn de patiënten die ouder zijn dan 40 jaar, patiënten met een ferritine boven de 1.000µg/l, patiënten met gestoorde transaminasen (7). In tijden van MRI met R2 relaxometrie en niet-invasieve elasticiteitsmeting van de lever (Fibroscan), is deze richtlijn zeker niet absoluut meer te volgen. Wat essentieel is, is dat bij de diagnose een duidelijk beeld van de aan- of afwezigheid van cirrose gevormd wordt, omdat dit de opvolging van de patiënt duidelijk zal beïnvloeden. Door een combinatie van kliniek, biochemie, beeldvorming en Fibroscan, kan dit betrouwbaar ingeschat worden. Ook om het ijzerstapelingspatroon in de lever te zien (Figuur 4), is een biopsie niet meer onontbeerlijk. MRI biedt namelijk de mogelijkheid om het ijzerstapelingspatroon op T2-beelden te evalueren (enkel in de lever vs. in lever, milt en beenmerg) (Figuur 3). behandeling De flebotomie (aderlating) is de hoeksteen van de behandeling van HFE-gerelateerde hemochromatose. Flebotomie is eenvoudig, goedkoop, veilig en effectief. Er wordt in principe gestart met een wekelijkse tot tweewekelijkse flebotomie, waarbij telkens ongeveer 500ml veneus bloed (het equivalent van 250mg ijzer) wordt afgenomen. Deze behandeling wordt uitgevoerd tot het serumferritine lager is dan 50µg/l. De streefwaarden voor de transferrinesaturatie (minder dan 75% of minder dan 45%) variëren volgens de bron. Dat is te verklaren doordat op heden niet duidelijk is wanneer de aderlatingen aanleiding geven tot een paradoxaal toegenomen ijzeropname vanuit de voeding, wat uiteraard niet wenselijk is. De richtlijnen zijn dus op heden niet meer dan dat: richtlijnen. Levenslange onderhoudstherapie is aangewezen, waarbij de uiteindelijke frequentie van flebotomieën sterk kan variëren, maar gemiddeld neerkomt op maandelijkse tot trimestriële onderhoudsflebotomieën. Daarnaast is het uiteraard aangewezen de verwikkelingen van HFE-

5 Algoritme voor de aanpak van hyperferritinemie Anamnese en klinisch onderzoek - Aanwijzingen voor inflammatie of maligniteit? - Normale BMI en bloeddruk? Metabool syndroom? - Transfusies? Ijzersubstitutie IM/IV? - Familiale anamnese - Geslacht - Alcoholinname Labo - CRP - Lipidenprofiel, glycemie, HbA1c - Ijzer, transferrine, transferrinesaturatie, ferritine en hun evolutie - Transaminasen (ALT, AST) - Hemoglobine, MCV, reticulocytose - Bilirubine, haptoglobine Beeldvorming - Echo lever - MRI lever (T2 beelden, evt. met R2 relaxometrie): zie tekst Wanneer door bovenstaande onderzoeken een secundaire ijzerstapeling of vals gestoorde ijzerparameters uitgesloten zijn: - Diabetesevaluatie (glycemie, HbA1c, OGTT) - Genetische testing: zie tekst - Fibroscan - Biopsie: zie tekst gerelateerde hemochromatose te behandelen (zoals diabetes, hypothyreoïdie, hypogonadisme, enz.). Bij patiënten met gevorderde leverfibrose of bewezen cirrose is echografische screening naar hepatocellulair carcinoma essentieel. Patiënten die geen flebotomieën kunnen ondergaan (omwille van anemie, hartziekten), kunnen behandeld worden met erythrocyt-aferese of chelatie-therapie. met aderlatingen, zullen ze een morbiditeit en mortaliteit vertonen die vergelijkbaar is met gezonde leeftijdsgenoten (11). Het is uiteraard aangewezen de verwikkelingen die aanwezig De prognose van HFE-gerelateerde hemochromatose wordt bepaald door de aanwezigheid van cirrose, diabetes en hepatocellulair carcinoma. zijn op het moment van diagnose te behandelen en op te volgen. Zo is het bv. essentieel dat patiënten met cirrose zesmaandelijks gescreend worden op hepatocellulair carcinoma. Het is een bewezen kost-effectieve strategie om eerstegraadsverwanten van symtomatische HFE-gerelateerde hemochromatosepatiënten genetisch te screenen, wanneer ze meer dan 18 jaar oud zijn. Jongere patiënten lopen geen risico om ziekte te ontwikkelen en moeten dus niet gescreend worden. Als ze 18 jaar oud worden, kunnen ze zelf beslissen of ze wensen genetisch onderzocht te worden. Populatiescreening voor HFE-gerelateerde hemochromatose wordt momenteel afgeraden door het Center for Disease Control and Prevention (1998 Consensus Statement) (12).) Wanneer patiënten met HFE-gerelateerde hemochromatose geen diabetes of cirrose hebben bij presentatie en adequaat behandeld worden met aderlatingen, zullen ze een morbiditeit en mortaliteit vertonen die vergelijkbaar is met gezonde leeftijdsgenoten. 5. Pietrangelo A. Hemochromatosis: an endocrine liver disease. Hepatology 2007;46: Brissot P, Troadec MB, Bardou-Jacquet E et al. Current approach to hemochromatosis. Blood Rev 2008;22(4): Tavill AS. Diagnosis and management of haemochromatosis. AASLD Practice Guidelines. Hepatology 2001;33: St Pierre TG, Clark PR, Chua-anusorn W et al. Noninvasive measurement and imaging of liver iron concentrations using proton magnetic resonance. Blood 2005;105(2): Pietrangelo A. Hereditary hemochromatosis a new look at an old disease. NEJM 2004;350: Deugnier Y, Brissot P, Loréal O. Iron and the liver: update J Hepatol 2008;48(suppl 1):S Niederau C, Fischer R, Pürschel A et al. Long-term survival in patients with hereditary hemochromatosis. Gastroenterology 1996;110: Reyes M, Khoury M. Screening for iron overload due to hereditary hemochromatosis. US Dept of Health and Human Services, Centers for Disease Control and Prevention. Beschikbaar op: screening.htm HFE-gerelateerde hemo-chromatose: opvolging, evolutie, familiescreening Wanneer patiënten met HFE-gerelateerde hemochromatose geen diabetes of cirrose hebben bij presentatie en adequaat behandeld worden Referenties 1. Adams PC, Barton JC. Haemochromatosis. Lancet 2007; 370: Swaminathan S, Fonseca VA, Alam MG, Shah SV. The role of iron in diabetes and its complications. Diabetes Care 2007;30(7): Selby JV, Friedman GD. Epidemiologic evidence of an association between body iron stores and risk of cancer. Int J Cancer 1988;41(5):677-82). 4. Zacharski LR, Chow BK, Howes PS et al. Decreased cancer risk after iron reduction in patients with peripheral arterial disease: results from a randomized trial. J Natl Cancer Inst 2008;100(14):

IJzer en de lever: verantwoord gebruik van de diagnostische middelen. Prof. Dr. C. Verslype Hepatologie

IJzer en de lever: verantwoord gebruik van de diagnostische middelen. Prof. Dr. C. Verslype Hepatologie IJzer en de lever: verantwoord gebruik van de diagnostische middelen Prof. Dr. C. Verslype Hepatologie Patiënten met ijzerstapeling Tijdige, zorgvuldige en adequate diagnostiek Zo goed mogelijke behandeling

Nadere informatie

Een eiig maar twee behandelingen. Martin Schipperus, Liane van Egmond Afdeling hematologie HagaZiekenhuis

Een eiig maar twee behandelingen. Martin Schipperus, Liane van Egmond Afdeling hematologie HagaZiekenhuis Een eiig maar twee behandelingen Martin Schipperus, Liane van Egmond Afdeling hematologie HagaZiekenhuis Aderlaten of isovolemische hemodilutie: Een ratrace? Heriditaire Hemochromatosis Hereditaire hemochromatose

Nadere informatie

Hemochromatose: wat is het..hoe kom je aan wat doe je eraan.hoe voelt het?

Hemochromatose: wat is het..hoe kom je aan wat doe je eraan.hoe voelt het? Hemochromatose: wat is het..hoe kom je aan wat doe je eraan.hoe voelt het? Wie ben ik? Wat is hemochromatose? Hoe kom je eraan? Wat doe je eraan? Wat zijn de complicaties van? Hoe voel U zich? Open spreek

Nadere informatie

Diagnostiek en behandeling van hereditaire hemochromatose

Diagnostiek en behandeling van hereditaire hemochromatose Diagnostiek en behandeling van hereditaire hemochromatose MCH Janssen 1, DW Swinkels 2 1 Afdeling Interne Geneeskunde, 2 Klinische Chemie Universitair Medisch Centrum St Radboud, Postbus 9101, 6500 HB

Nadere informatie

HEMOCHROMATOSE. - Patiëntinformatie -

HEMOCHROMATOSE. - Patiëntinformatie - HEMOCHROMATOSE - Patiëntinformatie - Deze brochure licht u in over de volwassen vorm van hereditaire (genetische of erfelijke) hemochromatose. Deze aandoening wordt veroorzaakt door een erfelijk bepaalde

Nadere informatie

Hemochromatose. de diagnose. versie 3

Hemochromatose. de diagnose. versie 3 Hemochromatose de diagnose versie 3 IJzerstofwisseling de diagnose 2 Diagnose de diagnose 3 Epidemiologie Prevalentie: 1 op de 200 personen homozygoot = 80.000 personen in Nederland. 1 op de 10 personen

Nadere informatie

Genetica van hemochromatose

Genetica van hemochromatose Genetica van hemochromatose 28-11-2015 Prof.Dr. M.H. Breuning, klinisch geneticus M.H.Breuning@lumc.nl Wat is ijzer? Twee oxidatietoestanden: Fe 2+ Fe 3+ (divalent) (trivalent) IJzer is noodzakelijk voor

Nadere informatie

IJzer en Cystic Fibrosis. Renske van der Meer Longarts-onderzoeker Haga Ziekenhuis

IJzer en Cystic Fibrosis. Renske van der Meer Longarts-onderzoeker Haga Ziekenhuis IJzer en Cystic Fibrosis Renske van der Meer Longarts-onderzoeker Haga Ziekenhuis Programma Inventarisatie Anemie algemeen oorzaken anemie gevolgen anemie Anemie bij CF IJzer bij CF: in het bloed in de

Nadere informatie

IJzermetabolisme en Anemie

IJzermetabolisme en Anemie Achtergrond richtlijn chronisch nierfalen (volwassenen) IJzermetabolisme en Anemie Inhoud 1. IJzermetabolisme 2. IJzerkringloop 3. IJzertekort 4. Behandeling renale anemie 5. Aandachtspunten bij gebruik

Nadere informatie

Informatiefilm HVN voor (huis)artsen

Informatiefilm HVN voor (huis)artsen Informatiefilm HVN voor (huis)artsen Gesproken tekst van de video met illustraties te downloaden als PDF Inhoud 1 Hemochromatose Vereniging Nederland... 2 2 De ijzerhuishouding... 2 3 IJzerstapeling...

Nadere informatie

Hemochromatose (ijzerstapeling) in de familie

Hemochromatose (ijzerstapeling) in de familie Hemochromatose (ijzerstapeling) in de familie Deze brochure is bedoeld als aanvulling op de gesprekken op bij de genetisch consulent en kan hier dus niet voor in de plaats komen. Algemene informatie wordt

Nadere informatie

Hereditaire hemochromatose in de huisartsenpraktijk:

Hereditaire hemochromatose in de huisartsenpraktijk: Hereditaire hemochromatose in de huisartsenpraktijk: effect van vaccinatie tegen HAV en HBV bij chronische leveraandoeningen. Dr. Hannelore Van Droogenbroeck, KU Leuven Promotor: Prof. Dr. Bert Aertgeerts,

Nadere informatie

Hemochromatose in de huisartsenpraktijk

Hemochromatose in de huisartsenpraktijk Hemochromatose in de huisartsenpraktijk Karen Van Massenhove, Universiteit Gent Promotor: Prof. Dr. An De Sutter, Vakgroep Huisartsgeneeskunde en eerstelijnslijnsgezondheidszorg, Universiteit Gent Co-promotor:

Nadere informatie

Laboratoriumonderzoek bij vraagstelling/behandeling anemie

Laboratoriumonderzoek bij vraagstelling/behandeling anemie Laboratoriumonderzoek bij vraagstelling/behandeling anemie 12 februari 2013 Dr. Anja Leyte Dr. Simone Smits Anemie Anemie: Hb lager dan de ondergrens van de referentiewaarde Man: 8.5-11.0 mmol/l Vrouw:

Nadere informatie

De vele gezichten van Hemochromatose

De vele gezichten van Hemochromatose De vele gezichten van Hemochromatose Contactdag HVN 26 september in Weert Spreker: drs. H. J. M. Jacobs Arts en voorzitter HVN versie 3 Hemochromatose de diagnose versie 3 Diagnose Voor het stellen van

Nadere informatie

Samenvatting van de richtlijn Diagnostiek en behandeling van hereditaire hemochromatose

Samenvatting van de richtlijn Diagnostiek en behandeling van hereditaire hemochromatose Samenvatting van de richtlijn Diagnostiek en behandeling van hereditaire hemochromatose Auteurs Trefwoorden D.W. Swinkels, A.T.M. Jorna, M.A. van Bokhoven, A. Castel, C.T.B.M. van Deursen, J.C. Giltay,

Nadere informatie

WORKSHOP ANEMIE. een Maastrichtse aanpak. Michel van Gelder internist-hematoloog

WORKSHOP ANEMIE. een Maastrichtse aanpak. Michel van Gelder internist-hematoloog WORKSHOP ANEMIE een Maastrichtse aanpak Michel van Gelder internist-hematoloog met dan aan: Sacha Zeerleder(hematoloog, AMC) & Arno Gingele(1 e jaarsaios, MUMC) Na deze Workshop ben je ONGETWIJFELD in

Nadere informatie

Aderlatingen bij ijzerstapeling Hemochromatose

Aderlatingen bij ijzerstapeling Hemochromatose Aderlatingen bij ijzerstapeling Hemochromatose Albert Schweitzer ziekenhuis mei 2015 pavo 1147 Inleiding Uw arts heeft met u besproken dat u de ziekte ijzerstapeling heeft en daarom met aderlatingen behandeld

Nadere informatie

Hyperferritinemie in de huisartsenpraktijk

Hyperferritinemie in de huisartsenpraktijk Hyperferritinemie in de huisartsenpraktijk door Karolien Meersman Promotor: Prof. Dr. D. Devroey Coördinator: Dr. B. Spinnewijn Dr. L. Pas Praktijkopleider: Dr. P. Meersman Dr. M. Brouillard ABSTRACT Inleiding:

Nadere informatie

Wat is hemochromatose?

Wat is hemochromatose? Wat is hemochromatose? Uitgebreide informatie over de gevolgen van een teveel aan ijzer en hoe dit te verhelpen Inhoud 1 Inleiding 3 2 Wat is hemochromatose? 3 3 Waarvoor heeft het lichaam 3 ijzer nodig?

Nadere informatie

Hereditaire hemochromatose als oorzaak van diabetes mellitus

Hereditaire hemochromatose als oorzaak van diabetes mellitus Tijdschr. voor Geneeskunde, 66, nr. 12, 2010 doi: 10.2143/TVG.66.12.2000774 593 OVERZICHT Hereditaire hemochromatose als oorzaak van diabetes mellitus W. HEGGERMONT 1, 5, P. DE RUDDER 2, D. CASSIMAN 3,

Nadere informatie

Verroest! Zit dat zo?

Verroest! Zit dat zo? Disclosure Verroest! Zit dat zo? laat de zon weer stralen met en ijzer (potentiele) belangenverstrengeling: geen (mogelijk) relevante relaties met bedrijven: geen menno kooistra ziekenhuis rijnstate arnhem

Nadere informatie

Het syndroom van Klinefelter: Screening en opvolging van metabole afwijkingen. David Unuane Endocrinologie Klinefelter Kliniek

Het syndroom van Klinefelter: Screening en opvolging van metabole afwijkingen. David Unuane Endocrinologie Klinefelter Kliniek Het syndroom van Klinefelter: Screening en opvolging van metabole afwijkingen David Unuane Endocrinologie Klinefelter Kliniek Achtergrond Het Klinefelter syndroom(ks): Genetisch kenmerk extra X-chromosoom:

Nadere informatie

IJzerstapeling in thalassemie, diagnostiek en behandeling. Bart J. Biemond. Introductie

IJzerstapeling in thalassemie, diagnostiek en behandeling. Bart J. Biemond. Introductie IJzerstapeling in thalassemie, diagnostiek en behandeling Bart J. Biemond Introductie Thalassemie is een erfelijke mutatie in het gen verantwoordelijk voor de synthese van alfaglobine ketens (alfa-thalassemie)

Nadere informatie

Hemochromatose (ijzerstapeling)

Hemochromatose (ijzerstapeling) Hemochromatose (ijzerstapeling) Inhoud 1. IJzerstapeling 1 Inleiding 1 Waarvoor heeft het lichaam ijzer nodig? 1 Hoe ontstaat ijzerstapeling? 2 Wat gebeurt er met een overschot aan ijzer? 2 Welke klachten

Nadere informatie

Hoofdstuk 2 Hoofdstuk 3

Hoofdstuk 2 Hoofdstuk 3 Samenvatting 11 Samenvatting Bloedarmoede, vaak aangeduid als anemie, is een veelbesproken onderwerp in de medische literatuur. Clinici en onderzoekers buigen zich al vele jaren over de oorzaken en gevolgen

Nadere informatie

How I treat hemochromatosis?

How I treat hemochromatosis? How I treat hemochromatosis? Moderator 1st author Anita Rijneveld Internist-hematoloog, Erasmus MC, Rotterdam Belangenverklaring In overeenstemming met de regels van de Inspectie van de Gezondheidszorg

Nadere informatie

Samenvat ting en Conclusies

Samenvat ting en Conclusies Samenvat ting en Conclusies Samenvatting en Conclusies 125 SAMENVAT TING EN CONCLUSIES In dit proefschrift werd de invloed van viscerale obesitas en daarmee samenhangende metabole ontregelingen, en het

Nadere informatie

NEDERLANDSE SAMENVATTING NIET-INGEWIJDEN

NEDERLANDSE SAMENVATTING NIET-INGEWIJDEN VOOR NEDERLANDSE SAMENVATTING NIET-INGEWIJDEN CHAPTER INLEIDING De nier heeft drie belangrijke functies in het menselijk lichaam: (1) het reguleren van de water- en zouthuishouding; (2) het verwijderen

Nadere informatie

UMC St Radboud. Hemochromatose (ijzerstapeling)

UMC St Radboud. Hemochromatose (ijzerstapeling) UMC St Radboud Hemochromatose (ijzerstapeling) Patiënteninformatie Inhoud 1. IJzerstapeling 1 Inleiding 1 Waarvoor heeft het lichaam ijzer nodig? 1 Hoe ontstaat ijzerstapeling? 2 Wat gebeurt er met een

Nadere informatie

NRLP-12 Gerelateerde Terugkerende Koorts

NRLP-12 Gerelateerde Terugkerende Koorts www.printo.it/pediatric-rheumatology/be_fm/intro NRLP-12 Gerelateerde Terugkerende Koorts Versie 2016 1. WAT IS NRLP-12 GERELATEERDE TERUGKERENDE KOORTS 1.1 Wat is het? NRLP-12 gerelateerde terugkerende

Nadere informatie

INTERNE GENEESKUNDE. Aderlating BEHANDELING

INTERNE GENEESKUNDE. Aderlating BEHANDELING INTERNE GENEESKUNDE Aderlating BEHANDELING Aderlating Binnenkort komt u naar de Dagbehandeling voor een aderlating. Hierbij wordt een bepaalde hoeveelheid bloed afgenomen om het ijzergehalte in uw bloed

Nadere informatie

Diabetes of suikerziekte

Diabetes of suikerziekte Diabetes of suikerziekte (bron: Weet je voldoende over diabetes - Vlaamse Diabetes Vereniging) SUIKER EN HET MENSELIJK LICHAAM In onze dagelijke voeding zijn tal van koolhydraten (=suikers) aanwezig. Deze

Nadere informatie

nederlandse samenvatting

nederlandse samenvatting Nederlandse Samenvatting NEDERLANDSE SAMENVATTING Inleiding Hartfalen is een syndroom, waarbij de pompfunctie van het hart achteruitgaat en dat onder andere gepaard kan gaan met klachten van kortademigheid

Nadere informatie

Referenties. Summary. Reagens Eenheid Negatief (%) Positief (%)

Referenties. Summary. Reagens Eenheid Negatief (%) Positief (%) gedrukt in genormaliseerde ratio is lager dan het percentage positieve resultaten uitgedrukt in PS. Dit geldt voor alle reagentia. Het percentage positieve resultaten is voor de reagenscombinatie Actin

Nadere informatie

11/01/2013. Een minuutje geduld. Geboorte.. De mens. Afklemmen van de navelstreng anno 2012 Controversieel? . andere zoogdieren

11/01/2013. Een minuutje geduld. Geboorte.. De mens. Afklemmen van de navelstreng anno 2012 Controversieel? . andere zoogdieren Geboorte.. De mens Een minuutje geduld Vroeg- of Laattijdig afnavelen Dr. David Van Laere Neonatoloog UZ Antwerpen. andere zoogdieren Afklemmen van de navelstreng anno 2012 Controversieel? Zoek de verschillen?

Nadere informatie

Wat as het misloopt met de lever! Slide Source:

Wat as het misloopt met de lever! Slide Source: Wat as het misloopt met de lever! Les geven in Zuid-Afrikaans :! LIFT Les geven in Zuid-Afrikaans :! LIFT = HYSBAK Les geven in Zuid-Afrikaans :! METRO? Les geven in Zuid-Afrikaans :! METRO= MOLTREIN Les

Nadere informatie

Trombocytose. Dr. Dimitri Breems, internist-hematoloog ZNA Stuivenberg ZNA Medisch Centrum Regatta 3 juni 2014

Trombocytose. Dr. Dimitri Breems, internist-hematoloog ZNA Stuivenberg ZNA Medisch Centrum Regatta 3 juni 2014 Trombocytose Dr. Dimitri Breems, internist-hematoloog ZNA Stuivenberg ZNA Medisch Centrum Regatta 3 juni 2014 Casus 1 Vrouw, 25 jaar Laboratoriumonderzoek hemoglobine 11,2 g/dl 11,0-14,4 hematocriet 0,341

Nadere informatie

Nederlandse samenvatting

Nederlandse samenvatting 169 Nederlandse samenvatting Het aantal ouderen boven de 70 jaar is de laatste jaren toegenomen. Dit komt door een significante reductie van sterfte op alle leeftijden waardoor een toename van de gemiddelde

Nadere informatie

NLRP-12 Gerelateerde Terugkerende Koorts

NLRP-12 Gerelateerde Terugkerende Koorts www.printo.it/pediatric-rheumatology/nl/intro NLRP-12 Gerelateerde Terugkerende Koorts Versie 2016 1. WAT IS NLRP12 GERELATEERDE TERUGKERENDE KOORTS 1.1 Wat is het? NLRP12 gerelateerde terugkerende koorts

Nadere informatie

Prediabetes : ontwikkelt iedereen diabetes? Wie screenen en hoe? C. De Block Endocrinologie-Diabetologie Voorzitter Diabetes Liga

Prediabetes : ontwikkelt iedereen diabetes? Wie screenen en hoe? C. De Block Endocrinologie-Diabetologie Voorzitter Diabetes Liga Prediabetes : ontwikkelt iedereen diabetes? Wie screenen en hoe? C. De Block Endocrinologie-Diabetologie Voorzitter Diabetes Liga Inhoudsweergave Wie is at risk & Diagnose Prevalentie Klinisch belang van

Nadere informatie

RICHTLIJN BASISPAKKET LABORATORIUMBEPALINGEN BIJ STABIELE CHRONISCHE CENTRUM HEMODIALYSEPATIËNT EN PERITONEALE DIALYSEPATIËNT

RICHTLIJN BASISPAKKET LABORATORIUMBEPALINGEN BIJ STABIELE CHRONISCHE CENTRUM HEMODIALYSEPATIËNT EN PERITONEALE DIALYSEPATIËNT RICHTLIJN BASISPAKKET LABORATORIUMBEPALINGEN BIJ STABIELE CHRONISCHE CENTRUM HEMODIALYSEPATIËNT EN PERITONEALE DIALYSEPATIËNT De richtlijn bevat aanbevelingen van algemene aard. Het is mogelijk dat in

Nadere informatie

Probleem-georienteerde kliniek Icterus. W. Van Steenbergen

Probleem-georienteerde kliniek Icterus. W. Van Steenbergen Probleem-georienteerde kliniek Icterus W. Van Steenbergen Arts 1, 2006-2007 Casus 1: Man, 53 jaar Raadpleging 06-09-2005 Sinds één week: Vermoeidheid Sclerale icterus, donkere urine, ontkleurde stoelgang

Nadere informatie

www.printo.it/pediatric-rheumatology/be_fm/intro Majeed Versie 2016 1. WAT IS MAJEED 1.1 Wat is het? Het Majeed syndroom is een zeldzame genetische aandoening. Kinderen met dit syndroom lijden aan chronische

Nadere informatie

Nederlandse samenvatting

Nederlandse samenvatting Nederlandse samenvatting 138 Nederlandse samenvatting Nederlandse samenvatting Een belangrijke functie van de nier is het uitscheiden van afvalstoffen via de urine. Grote hoeveelheden water en kleine stoffen

Nadere informatie

Bloedwaarden. Wat zeggen ze en wat kunnen we er mee? Landelijke contactdag Stichting Hematon 11 oktober 2014. door Joost Lips

Bloedwaarden. Wat zeggen ze en wat kunnen we er mee? Landelijke contactdag Stichting Hematon 11 oktober 2014. door Joost Lips Bloedwaarden Wat zeggen ze en wat kunnen we er mee? Landelijke contactdag Stichting Hematon 11 oktober 2014 door Joost Lips Aanvraag bloedonderzoek Bloedafname Bewerking afgenomen bloed (1) Kleuren van

Nadere informatie

212

212 212 Type 2 diabetes is een chronische aandoening, gekarakteriseerd door verhoogde glucosewaarden (hyperglycemie), die wereldwijd steeds vaker voorkomt (stijgende prevalentie) en geassocieerd is met vele

Nadere informatie

GENETISCHE COUNSELING SYLVIA DE NOBELE, GENETISCH COUNSELOR CENTRUM MEDISCHE GENETICA, UZGENT (CMGG) FAPA 19/11/2016

GENETISCHE COUNSELING SYLVIA DE NOBELE, GENETISCH COUNSELOR CENTRUM MEDISCHE GENETICA, UZGENT (CMGG) FAPA 19/11/2016 GENETISCHE COUNSELING SYLVIA DE NOBELE, GENETISCH COUNSELOR CENTRUM MEDISCHE GENETICA, UZGENT (CMGG) FAPA 19/11/2016 INHOUD 1. Erfelijke dikkedarmkanker 2. Betrokken genen en overerving 3. DNA, chromosomen

Nadere informatie

Java Project on Periodontal Disease. Periodontal Condition in Relation to Vitamin C, Systemic Conditions and Tooth Loss Amaliya

Java Project on Periodontal Disease. Periodontal Condition in Relation to Vitamin C, Systemic Conditions and Tooth Loss Amaliya Java Project on Periodontal Disease. Periodontal Condition in Relation to Vitamin C, Systemic Conditions and Tooth Loss Amaliya Samenvatting en conclusie In vele studies is een verband aangetoond tussen

Nadere informatie

Diabetes Mellitus en Beweging

Diabetes Mellitus en Beweging Diabetes Mellitus en Beweging Doelen 0Refresher 0Patient Education 0Exercise and DM Wat betekent het? 0 Diabetes: Door(heen) gaan 0 Mellitus: Honing/Zoet Wat is het? 0 Groep van stoornissen met hyperglycemieën

Nadere informatie

Nederlandse samenvatting

Nederlandse samenvatting Nederlandse samenvatting 157 N ederlandse samenvatting Nederlandse Samenvatting 158 Nederlandse samenvatting Het aantal gevallen van huidkanker, waaronder melanoom, neemt nog steeds toe in de westerse

Nadere informatie

Voedingsadvies bij HFE-hemochromatose

Voedingsadvies bij HFE-hemochromatose Voedingsadvies bij HFE-hemochromatose Een project van de Wetenschapswinkel Wageningen UR uitgevoerd voor de Hemochromatose Vereniging Nederland 17 maart 2012, Gerdien van Doorn, MSc Voedingsadvies bij

Nadere informatie

matige alcohol consumptie gezondheid

matige alcohol consumptie gezondheid matige alcohol consumptie positief voor gezondheid R e s u l t a t e n v a n 3 j a a r w e t e n s c h a p p e l i j k o n d e r z o e k Matige en regelmatige alcoholconsumptie heeft overall een positief

Nadere informatie

Diagnostiek bij 5 patiënten met mogelijk primaire hemochromatose

Diagnostiek bij 5 patiënten met mogelijk primaire hemochromatose Casuïstische mededelingen Diagnostiek bij 5 patiënten met mogelijk primaire hemochromatose e.m.g.jacobs, r.a.de vries, l.d.elving, a.f.h.stalenhoef en d.w.swinkels Hemochromatose(HFE)-gengerelateerde primaire

Nadere informatie

Hemochromatose en bloeddonatie: van wetenschappelijke evidentie tot wetgeving. Veerle Compernolle

Hemochromatose en bloeddonatie: van wetenschappelijke evidentie tot wetgeving. Veerle Compernolle Hemochromatose en bloeddonatie: van wetenschappelijke evidentie tot wetgeving Veerle Compernolle 09/12/2016 - Rode Kruis-Vlaanderen - Hemochromatose Genetische variatie - ijzermetabolisme Blood, Camaschella

Nadere informatie

Hereditair hyperferritinemiecataractsyndroom

Hereditair hyperferritinemiecataractsyndroom Casuïstiek 2 Hereditair hyperferritinemiecataractsyndroom Hereditary hyperferritinaemia cataract syndrome M.J.A. Kamps*, M.M.G.J. van Borren*, J. Leuvenink en J.F.M. Pruijt * Auteurs hebben evenveel bijgedragen

Nadere informatie

Lessenreeks Hematologie. Anemie. Diagnose en Gebreksanemieën. Caroline Brusselmans & Pieter Vermeersch LAG

Lessenreeks Hematologie. Anemie. Diagnose en Gebreksanemieën. Caroline Brusselmans & Pieter Vermeersch LAG Lessenreeks Hematologie Anemie Diagnose en Gebreksanemieën Wat is Anemie? Definitie Reductie in het totale aantal RBC, de hoeveelheid hemoglobine of de RBC massa (hematocriet) verminderd zuurstoftransport

Nadere informatie

If Yes, date of informed consent: d d m m m y y y y

If Yes, date of informed consent: d d m m m y y y y In- en exclusie criteria Page 1 of 1 Patient Identification Number: Pag 1 van 6 In- en exclusie criteria Inclusion criteria Yes No 1. Getekende informed consent 2. Leeftijd van 18 jaar en ouder 3. M0-stadium

Nadere informatie

Vereniging voor Ziekenhuisgeneeskunde

Vereniging voor Ziekenhuisgeneeskunde Vereniging voor Ziekenhuisgeneeskunde SHELLEY METSELAAR AIOS SOZG Achtergrond Incidentie - 5-11 per 1000 per jaar 1 Diagnose - Combinatie kliniek, lab, X-thorax Sensitiviteit X-thorax 2 - Pneumonie +/-

Nadere informatie

Nederlandse samenvatting

Nederlandse samenvatting Nederlandse samenvatting Thiopurines en inflammatoir darmlijden; farmacologie en toxiciteit Dit proefschrift beschrijft nieuwe farmacologische en toxicologische inzichten in het gebruik van thiopurine

Nadere informatie

Blau Syndroom/Juveniele Sarcoïdose

Blau Syndroom/Juveniele Sarcoïdose www.printo.it/pediatric-rheumatology/nl/intro Blau Syndroom/Juveniele Sarcoïdose Versie 2016 1. WAT IS DE ZIEKTE VAN BLAU/JUVENIELE SARCOÏDOSE 1.1 Wat is het? Het Blau syndroom is een genetische aandoening.

Nadere informatie

Chapter. De Longcirculatie in Pulmonale Hypertensie. Nieuwe inzichten in Rechter Ventrikel- & Longfysiologie. Nederlandse samenvatting

Chapter. De Longcirculatie in Pulmonale Hypertensie. Nieuwe inzichten in Rechter Ventrikel- & Longfysiologie. Nederlandse samenvatting Chapter 9 Nederlandse samenvatting De Longcirculatie in Pulmonale Hypertensie Nieuwe inzichten in Rechter Ventrikel- & Longfysiologie Samenvatting Pulmonale arteriële hypertensie is een ziekte van de longvaten,

Nadere informatie

Bevolkingsonderzoek Familiaire Hypercholesterolemie

Bevolkingsonderzoek Familiaire Hypercholesterolemie Bevolkingsonderzoek Familiaire Hypercholesterolemie Casuïstiek Mw. K, slanke en sportieve 30 jarige vrouw wordt verwezen voor behandeling van haar verhoogde cholesterol. Haar vader kreeg op 57 jarige leeftijd

Nadere informatie

Reflecterend testen in de huisartsenpraktijk. Rein Hoedemakers / Peter van t Sant Klinisch chemici

Reflecterend testen in de huisartsenpraktijk. Rein Hoedemakers / Peter van t Sant Klinisch chemici Reflecterend testen in de huisartsenpraktijk Rein Hoedemakers / Peter van t Sant Klinisch chemici Wat kunt u verwachten? Wat is reflecterend testen? Waarom reflecterend testen? Voorbeelden uit de praktijk.

Nadere informatie

Lipiden, Diabetes en Cardiovasculair Risicomanagement. 17 januari 2013, Utrecht Dr. Janneke Wittekoek, Cardioloog Stichting Actief Preventie Plan

Lipiden, Diabetes en Cardiovasculair Risicomanagement. 17 januari 2013, Utrecht Dr. Janneke Wittekoek, Cardioloog Stichting Actief Preventie Plan Lipiden, Diabetes en Cardiovasculair Risicomanagement 17 januari 2013, Utrecht Dr. Janneke Wittekoek, Cardioloog Stichting Actief Preventie Plan Vet in Historisch Perspectief simpele vetopstapelingsziekte

Nadere informatie

Van mens tot Cel oefenvragen 1. De celdeling bestaat uit verschillende fasen. Hoe heten de G1, S en de G2 fase samen?

Van mens tot Cel oefenvragen 1. De celdeling bestaat uit verschillende fasen. Hoe heten de G1, S en de G2 fase samen? Van mens tot Cel oefenvragen 1. De celdeling bestaat uit verschillende fasen. Hoe heten de G1, S en de G2 fase samen? A: interfase B: profase C: anafase D: cytokinese 2. Een SNP (single nucleotide polymorphism)

Nadere informatie

Kent u de cijfers van uw hart?

Kent u de cijfers van uw hart? Kent u de cijfers van uw hart? CHOLESTEROL? GEWICHT/ BUIKOMTREK? UW? BLOEDDRUK? SUIKERGEHALTE? V.U.: Dr Freddy Van de Casseye - Elyzeese-Veldenstraat 63-1050 Brussel Belgische Cardiologische Liga www.cardiologischeliga.be

Nadere informatie

Amyloïd-bindende eiwitten bij de ziekte van Alzheimer

Amyloïd-bindende eiwitten bij de ziekte van Alzheimer Amyloïd-bindende eiwitten bij de ziekte van Alzheimer Introductie onderzoeksproject De ziekte van Alzheimer De ziekte van Alzheimer is een neurologische aandoening en is de meest voorkomende vorm van dementie.

Nadere informatie

Cover Page. The handle http://hdl.handle.net/1887/32551 holds various files of this Leiden University dissertation.

Cover Page. The handle http://hdl.handle.net/1887/32551 holds various files of this Leiden University dissertation. Cover Page The handle http://hdl.handle.net/1887/32551 holds various files of this Leiden University dissertation. Author: Krol, Charlotte Georgette Title: Pitfalls in the diagnosis and management of skeletal

Nadere informatie

De ziekte van Wilson voor patienten en familie

De ziekte van Wilson voor patienten en familie De ziekte van Wilson voor patienten en familie 1 / 14 Wat is de ziekte van Wilson? De ziekte van Wilson is een erfelijke aandoening waarbij koper onvoldoende door het lichaam wordt uitgescheiden. Het overschot

Nadere informatie

Resultaten voor Brussels Gewest Cardiovasculaire Preventie Gezondheidsenquête, België, 1997

Resultaten voor Brussels Gewest Cardiovasculaire Preventie Gezondheidsenquête, België, 1997 6.8.1. Inleiding In deze module worden 2 specifieke preventiedomeinen behandeld: de hypertensie en de hypercholesterolemie. De hart- en vaatziekten zijn aandoeningen die uit het oogpunt van volksgezondheid,

Nadere informatie

Leverenzymstoornissen. Peter van Bommel, Dirk Bakkeren & Martijn ter Borg

Leverenzymstoornissen. Peter van Bommel, Dirk Bakkeren & Martijn ter Borg Leverenzymstoornissen Peter van Bommel, Dirk Bakkeren & Martijn ter Borg Vrouw, 30jaar komt op mijn spreekuur Na anamnese en LO sluit ik een leverprobleem niet uit. Ik vraag probleemgeoriënteerd labonderzoek

Nadere informatie

Adviseren over specialistisch onderzoek: hemoglobinopathieën

Adviseren over specialistisch onderzoek: hemoglobinopathieën Adviseren over specialistisch onderzoek: hemoglobinopathieën PAOKC-cursus Consultverlening Ede, 19 september 2013 dr. Henk J. Adriaansen Klinisch Chemisch & Hematologisch Laboratorium, Gelre Ziekenhuizen,

Nadere informatie

Laboratorium & kliniek

Laboratorium & kliniek Laboratorium & kliniek Bron: leidse-land.nl F.J.A. van Meeteren, arts, dmcc 1 2 Patiënt 1 Vrouw van 24 jaar uit Tunesië. Ze is sedert 3 weken in ons land. Ze bezoekt de huisarts met lichte koorts (38,1

Nadere informatie

WAT IS HYPOGLYKEMIE? 1.1 Inleiding 11 INLEIDING

WAT IS HYPOGLYKEMIE? 1.1 Inleiding 11 INLEIDING HYPOGLEKEMIE_BINNENWERK_48 x 20 (A5) 4-4 3--2 0:2 Pagina WAT IS HYPOGLYKEMIE?. Inleiding Philip Cryer, een vooraanstaand Amerikaans diabetoloog, heeft aangetoond en beschreven dat hypoglykemie de belangrijkste

Nadere informatie

Hoe kijken we naar het DNA van een patiënt?

Hoe kijken we naar het DNA van een patiënt? Hoe kijken we naar het DNA van een patiënt? Ies Nijman UMC Utrecht Dept of Genetics, Centre for Molecular Medicine Center for Personalized Cancer Treatment (CPCT), Hartwig Medical Foundation 1994 DNA sequenties,

Nadere informatie

Diagnostiek en behandeling van hereditaire hemochromatose

Diagnostiek en behandeling van hereditaire hemochromatose Diagnostiek en behandeling van hereditaire hemochromatose Initiatief Nederlandsche Internisten Vereeniging (NIV) Nederlandse Vereniging voor Klinische Chemie en Laboratoriumgeneeskunde en Vereniging Artsen

Nadere informatie

Familiaire Hypercholesterolemie - Richtlijnen voor exacte, uniforme diagnostiek

Familiaire Hypercholesterolemie - Richtlijnen voor exacte, uniforme diagnostiek Familiaire Hypercholesterolemie - Richtlijnen voor exacte, uniforme diagnostiek Familiaire Hypercholesterolemie (FH) is een van de meest voorkomende ernstige metabole aandoeningen die wij kennen. De incidentie

Nadere informatie

Bijlagen bij het rapport: Voedingsadvies bij HFE-hemochromatose

Bijlagen bij het rapport: Voedingsadvies bij HFE-hemochromatose Bijlagen bij het rapport: Voedingsadvies bij HFE-hemochromatose Gerdien (G.M.) van Doorn MSc (Departement Humane Voeding, Wageningen University) Met medewerking van: Ir. Irene (I.M.G.) Gosselink (Plant

Nadere informatie

Afweer: 3 Barrières / Wat / Waar

Afweer: 3 Barrières / Wat / Waar Afweer: 3 Barrières / Wat / Waar ASPECIFIEKE AFWEER Primaire / Externe bescherming (fysieke barrière) (AANGEBOREN) Secundaire / Interne bescherming (cellulaire / biochemische barrière) SPECIFIEKE AFWEER

Nadere informatie

www.printo.it/pediatric-rheumatology/be_fm/intro De Ziekte van Behçet Versie 2016 2. DIAGNOSE EN THERAPIE 2.1 Hoe wordt het gediagnosticeerd? De diagnose is voornamelijk klinisch. Het kan een tot vijf

Nadere informatie

hematoloog dr. Uw specialist is op werkdagen tussen 08.30 17.00 uur bereikbaar via de polikliniek Interne geneeskunde, tel. (078) 654 64 64.

hematoloog dr. Uw specialist is op werkdagen tussen 08.30 17.00 uur bereikbaar via de polikliniek Interne geneeskunde, tel. (078) 654 64 64. Polycythemia Vera Uw hoofdbehandelaar is: hematoloog dr. Uw specialist is op werkdagen tussen 08.30 17.00 uur bereikbaar via de polikliniek Interne geneeskunde, tel. (078) 654 64 64. Inleiding U heeft

Nadere informatie

2. Erfelijkheid en de ziekte van Huntington

2. Erfelijkheid en de ziekte van Huntington 2. Erfelijkheid en de ziekte van Huntington Erfelijkheid Erfelijk materiaal in de 46 chromosomen De mens heeft in de kern van elke lichaamscel 46 chromosomen: het gaat om 22 paar lichaamsbepalende chromosomen

Nadere informatie

hoofdstuk één hoofdstuk twee

hoofdstuk één hoofdstuk twee Dit proefschrift beschrijft onderzoek naar hemolytische foetale bloedarmoede en foetale hydrops. Hemolytische foetale bloedarmoede ontstaat door afbraak van rode bloedcellen. Foetale hydrops betreft het

Nadere informatie

www.printo.it/pediatric-rheumatology/nl/intro De Ziekte Van Behçet Versie 2016 2. DIAGNOSE EN THERAPIE 2.1 Hoe wordt het gediagnosticeerd? De diagnose is voornamelijk klinisch. Het kan een tot vijf jaar

Nadere informatie

SAMENVATTING SAMENVATTING

SAMENVATTING SAMENVATTING HbA 1c ontstaat door de versuikering van hemoglobine, het belangrijkste bestanddeel van rode bloedcellen. In het bloed bindt een glucosemolecuul (niet-enzymatisch) met een aminozuur van de β-keten van

Nadere informatie

Chapter 9 Samenvatting

Chapter 9 Samenvatting Samenvatting Marcel D. Posthumus SAMENVATTING Reumatoïde artritis (RA) is een aandoening die voorkomt bij 0,5-1% van de bevolking en die gekenmerkt wordt door een chronische ontsteking van meerdere gewrichten

Nadere informatie

Algemene aspecten van erfelijkheid. Waarom is kennis over erfelijke aspecten van een ziekte belangrijk? Wanneer erfelijkheidsadvies/onderzoek?

Algemene aspecten van erfelijkheid. Waarom is kennis over erfelijke aspecten van een ziekte belangrijk? Wanneer erfelijkheidsadvies/onderzoek? Erfelijke nierziekten: algemene aspecten van erfelijkheid, overerving en erfelijkheidsadvies Nine Knoers Klinisch Geneticus Commissie Erfelijke Nierziekten NVN 4 november 2006 HUMAN GENETICS NIJMEGEN Inhoud

Nadere informatie

ARTERIELE HYPERTENSIE

ARTERIELE HYPERTENSIE ARTERIELE HYPERTENSIE Wat u moet weten - Patiëntinformatie - Hypertensie is de medische term voor hoge bloeddruk. Dat is de druk waaraan de arteriële bloedvaten of slagaders in het lichaam blootgesteld

Nadere informatie

hoofdstuk 3 hoofdstuk 4 hoofdstuk 5

hoofdstuk 3 hoofdstuk 4 hoofdstuk 5 Samenvatting Samenvatting De lever heeft een aantal belangrijke functies, waaronder het produceren van gal en het verwerken en afbreken van schadelijke verbindingen. Zij bestaat uit verschillende soorten

Nadere informatie

Dia 1 Lipiden, Diabetes en Cardiovasculair Risicomanagement. Dia 2. Dia 3. Vet in Historisch Perspectief. simpele vetopstapelingsziekte

Dia 1 Lipiden, Diabetes en Cardiovasculair Risicomanagement. Dia 2. Dia 3. Vet in Historisch Perspectief. simpele vetopstapelingsziekte Dia 1 Lipiden, Diabetes en Cardiovasculair Risicomanagement 17 januari 2013, Utrecht Dr. Janneke Wittekoek, Cardioloog Stichting Actief Preventie Plan Dia 2 Vet in Historisch Perspectief simpele vetopstapelingsziekte

Nadere informatie

Mevalonaat Kinase Deficientië (MKD) (of Hyper IgD syndroom)

Mevalonaat Kinase Deficientië (MKD) (of Hyper IgD syndroom) www.printo.it/pediatric-rheumatology/be_fm/intro Mevalonaat Kinase Deficientië (MKD) (of Hyper IgD syndroom) Versie 2016 1. WAT IS MKD 1.1 Wat is het? Mevanolaat kinase deficiëntie is een genetische aandoening.

Nadere informatie

Nederlandse Samenvatting

Nederlandse Samenvatting 9 Nederlandse Samenvatting F.S. de Man 1,2, N. Westerhof 1,2, A. Vonk-Noordegraaf 1 Departments of 1 Pulmonology and 2 Physiology, VU University Medical Center / Institute for Cardiovascular Research,

Nadere informatie

IJzerdeficiëntie en ijzerstapeling

IJzerdeficiëntie en ijzerstapeling Lezingen IJzerdeficiëntie en ijzerstapeling J.J.M. MARX Afdeling Interne Geneeskunde, UMC Utrecht Om de diagnostiek en behandeling van ijzergebrek en ijzerstapeling goed te kunnen begrijpen is het nodig

Nadere informatie

De ziekte van Alzheimer. Diagnose

De ziekte van Alzheimer. Diagnose De ziekte van Alzheimer Bij dementie is er sprake van een globale achteruitgang van de cognitieve functies, zoals het geheugen of de taalfuncties. Deze achteruitgang leidt tot functionele beperkingen in

Nadere informatie

Resultaten voor Vlaamse Gemeenschap Cardiovasculaire Preventie Gezondheidsenquête, België, 1997

Resultaten voor Vlaamse Gemeenschap Cardiovasculaire Preventie Gezondheidsenquête, België, 1997 6.8.1. Inleiding In deze module worden 2 specifieke preventiedomeinen behandeld: de hypertensie en de hypercholesterolemie. De hart- en vaatziekten zijn aandoeningen die uit het oogpunt van volksgezondheid,

Nadere informatie

NIERZIEKTEN WEGWIJS IN UW BLOEDUITSLAGEN

NIERZIEKTEN WEGWIJS IN UW BLOEDUITSLAGEN NIERZIEKTEN WEGWIJS IN UW BLOEDUITSLAGEN WEGWIJS IN UW BLOEDUITSLAGEN 03 Rode bloedcellen 03 Witte bloedcellen 04 Bloedplaatjes 04 Hematocriet 04 Hemoglobine 04 Ureum 05 Creatinine 05 Urinezuur 05 Natrium

Nadere informatie

Adjuvante systeemtherapie Patiënte: DM type 2

Adjuvante systeemtherapie Patiënte: DM type 2 Take home messages Een 59 jarige vrouw met mammacarcinoom en diabetes. An Reyners Internist-oncoloog UMCG Kankerbehandeling: houd rekening met bijwerkingen op korte en langere termijn Stem af wie waarvoor

Nadere informatie

Richtlijnen voor screening en follow-up bij Familiale Adenomateuze Polyposis (FAP)

Richtlijnen voor screening en follow-up bij Familiale Adenomateuze Polyposis (FAP) Richtlijnen voor screening en follow-up bij Familiale Adenomateuze Polyposis (FAP) 12/09/2007 Overzicht Patiënten met klassieke familiale adenomateuze polyposis (FAP) 1. Endoscopische follow-up na heelkunde

Nadere informatie

PSA-screening To do or not to do? Dr. Ludo Vanden Bussche uroloog

PSA-screening To do or not to do? Dr. Ludo Vanden Bussche uroloog PSA-screening To do or not to do? Dr. Ludo Vanden Bussche uroloog CIJFERS VLAANDEREN 2010 - MANNEN AANTAL STERFTE OVERLEVING 5 JAAR STERFTE > 80 JAAR PROSTAAT 5651 916 93% 54% LONG 3348 2937 14% 25,6%

Nadere informatie