Bio-informatica Computers and networks. Peter De Rijk

Maat: px
Weergave met pagina beginnen:

Download "Bio-informatica Computers and networks. Peter De Rijk"

Transcriptie

1 Bio-informatica Computers and networks Peter De Rijk 2

2 Operating/Besturings - systemen Windows / Mac Dikwijls gebruikt voor client software - betalen per PC Commerciele software Unix Meeste bioinformatica software is oorspronkelijk geschreven voor Unix Servers: dure speciale hardware In vele groepen ontbreekt de expertise Linux Gratis en vrij alternatief voor Unix op standaard pc's Vele programma's zijn geporteerd Clustering: meerdere PC's verzameld voor hogere rekenkracht Veel webservers, google,...

3 Interfaces Graphical User Interface: GUI Windows met menus, knoppen, invulvelden,... Bediend met muis/touch Gemakkelijk gebruik Commando lijn tekstuele commandos met parameters Unix achtergrond Zeer flexibele mogelijkheden voor glueing WWW interfaces grafische interfaces Roepen dikwijls onderliggend commando lijn commandos op

4 Data opslag: in een File/bestand File Een file bestaat uit een opeenvolging van bytes met een bepaalde lengte 1 byte = 8 bits 1 bit = 1 of 0 Dit geeft 256 verschillende combinaties: elke combinatie is genummerd van Metadata beschrijven de gegevens over de reeks bytes waaruit de file bestaat Filenaam Datum, grootte,... welke soort en wat voor gegevens (file formaat)

5 Data opslag: in een File/bestand File formaat Bepaalt wat deze reeks bytes betekenen Elk programma verwacht de gegevens in een bepaald formaat (sommige kennen wel meerdere formaten) In Windows aangegeven door de extensie van de filenaam, bv..doc voor word files Het veranderen van de naam/extensie verandert niet de data

6 Text vs. binary Tekst Files (flatfile) Extensie.txt Meestal 1 op 1 overeenkomst tussen bytes en karakters (letters, cijfers,...) vb. Byte 65= A Geen gegevens over fonts, formattering, tenzij via markup Voorbeelden Programma sources Readme Data Binaire Files Al wat geen tekst bestand is volgens definitie tekst file bv. getallen binair opgeslagen in 4 bytes Beelden, geluid, Word bestanden!!...

7 Tekst files ASCII American Standard Code for Information Interchange 1 byte komt overeen met 1 karakter De eerste bit is steeds een '0' met de andere 7 bites wordt het karakter gevormd = 7 bit codering (enkel mogelijkheden worden gebruikt) speciale controle karakters carriage return (cr), line feed (lf), beep,... (oorsprong teleprinter) Extra karakters (accenten, e.d.) in Verschillen in bv. aanduiden van een nieuwe lijn in DOS (cr+lf), oudere Mac OS (cr) en Unix (lf)

8 Tekst files Unicode Multilinguaal: kan coderen voor karakters Encodering UTF-32: 32bits (=4 bytes) per karakter UTF-8: variabele lengte (dus zonder speciale karakters is dit hetzelfde als ASCII)

9 Geformatteerde tekst files Het formaat van de tekst wordt bepaald door: Syntax Structuur / formaat van de gegevens Afspraken over hoe gegevens in een file staan Plaatsing, spatiëring, karakters gebruikt voor scheiding van velden, Semantiek Welke gegevens staan in een bepaald type van file Wat betekenen deze gegevens Welke restricties op bv. vocabulaire

10 Voorbeelden geformatteerde tekst files Comma separated value:.csv Tabel gegevens Een lijn = een rij Kolommen gescheiden door komma's (Engelstalige landen) Syntax soms afhankelijk van land/taal, bv. ; in België Ook vaak TAB characters als scheiding van kolommen (tsv of tab separated value)

11 Voorbeelden geformatteerde tekst files Markup languages extra gegevens over de tekst (formattering, betekenis,...) verwerkt in de tekst door elementen met specifieke syntax (tags, markup) bv. html, xml, TeX,...

12 Html (hyper text markup language) <html> <head> <title> Another simple HTML example </title> </head> <body> <h1> This is a level-one heading </h1> Welcome to the world of HTML. <p> This is one paragraph. </p> <p> This is a <b>second paragraph</b>. </p> </body> </html> Speciale vastgelegde codes om eigenschappen aan te geven van de tekst, bv.: <h1> voor een level1 titeltje, <b> voor bold De codes zie je niet in de uiteindelijke weergave van de tekst Tags beginnend met een / in de code geven het einde van de eigenschap aan

13 XML (extensible Markup Language) Syntax lijkt op HTML, maar de mogelijke tags zijn niet vastgelegd Je kan eigen codes bijmaken/definieren Hierarchisch georganiseerde elementen Tags tags hebben de vorm <tagname>element</tagname> definitie van het element kunnen eventueel parameters hebben Beschrijving van wat de beperkingen zijn en welke mogelijke elementen in een bepaald type XML mogen worden beschreven in: DTD (Document Type Description) XML schemas Verschillende soorten XML files naar gelang het soort gegevens bv. BSML (Bioinformatic Sequence Markup Language) <Sequence molecule="aa" length="8"> <Seq-data> akffglkl </Seq-data> </Sequence>

14 Formaten gebruikt in biologie Formaten Vaak tekst files Vele verschillende formaten voor gelijkende gegevens The beauty of standards is that there are so many to choose from Definities van formaat niet altijd extensief / afhankelijk van programma Formaat conversie Probleem: Gegevens in een formaat, dat het programma dat we willen gebruiken niet begrijpt Oplossing: Programma's voor omzetting Readseq Converteert tussen vele sequentie formaten Verlies van bv. annotatie informatie Sequence Manipulation Suite Manueel in tekst editor: macro's!

15 Formaten gebruikt in biologie Voorbeelden FASTA file Sequentie gegevens Lijn beginnend met > start van een nieuwe entry Naam staat achter het > karakter Volgende lijnen bevatten de sequentie (IUPAC codes) Genbank (zie verder) Sequenties met annotatie gegevens EMBL (zie verder) DCSE Sequenties met annotatie gegevens Gealigneerde sequenties eventueel met structuur gegevens

16 FASTA formaat >Lamprey GLOBIN V (SEA LAMPREY) PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGL TTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFK VLAAVIADTVAAGDAGFEKLMSMICILLRSAY >Hagfish GLOBIN III (ATLANTIC HAGFISH) PITDHGQPPTLSEGDKKAIRESWPQIYKNFEQNSLAVLLEFLKKFPKAQDSFPKFSAK KSHLEQDPAVKLQAEVIINAVNHTIGLMDKEAAMKKYLKDLSTKHSTEFQVNPDMFK ELSAVFVSTMGGKAAYEKLFSIIATLLRSTYDA >Frog HEMOGLOBIN BETA CHAIN (EDIBLE FROG) GSDLVSGFWGKVDAHKIGGEALARLLVVYPWTQRYFTTFGNL GSADAICHNAKVLAHGEKVLAAIGEGLKHPENLKAHYAKLSEYHSNKLHVDPANFRLLGNVFIT VLARHFQHEFTPELQHALEAHFCAVGDALAKAYH >African Elephant HEMOGLOBIN BETA CHAIN (AFRICAN ELEPHANT) VNLTAAEKTQVTNLWGKVNVKELGGEALSRLLVVYPWTRRFFEHFGDL STAEAVLHNAKVLAHGEKVLTSFGEGLKHLDNLKGTFADLSELHCDKLHVDPENFRLLGNVLVI VLARHFGKEFTPDVQAAYEKVVAGVANALAHKYH

17 Programmeertalen Machine code Enige taal die de processor begrijpt Specifiek voor processor (vb. Intel) en PC architectuur Meest performant Rechtstreekse toegang tot hardware Zeer moeilijk om in te programmeren Gemakkelijk grote fouten met zware gevolgen Assembler: tussenvorm (woorden ipv bytes)

18 Gecompileerde talen hogere programmeertalen Eenvoudiger om in te programmeren De broncode (source) van het programma wordt door een ander programma (compiler) omgezet in machine code die uitvoerbaar is op de machine (binary) Portabiliteit Dezelfde broncode kan gecompileerd worden voor verschillende architecturen Enkele voorbeelden Fortran Oudere gecompileerde taal Vooral gebruikt (nu soms nog) in numerieke analyse C, C++ meest gebruikte talen Performant en flexibel Gevaar voor fouten

19 Java Object georiënteerde hogere programmeertaal Minder kans op programmeer fouten Meer controles dan C/C++ Automatisch geheugen beheer Virtual machine Compile once, run everywhere Java code wordt niet gecompileerd naar de architectuur specifieke machine code,maar naar een soort tussencode voor een virtuele machine. Deze wordt uitgevoerd door een programma (JVM) dat wel architectuur specifiek is (= platform onafhankelijk). JVM werd geïntegreerd in browsers: Java programma's kunnen lopen in een browser (platform onafhankelijk)

20 Scripting talen Very High Level Languages Vele constructies zitten in de taal ingebouwd Veel gemakkelijker om in te programmeren (dynamic typing,...) Voordelen Platform onafhankelijk Geïnterpreteerde talen: De broncode (source) wordt rechtstreeks uitgevoerd door een platform specifiek programma (interpreter) Byte-compilatie: o.w.v. performantie wordt de broncode op de moment dat ze geladen word omgezet in een efficiëntere tussencode (byte-code) Glue languages zeer gemakkelijk aan elkaar hangen van verschillende programma's Testen in interactief gebruik is mogelijk Perl, Tcl, Python worden veel gebruikt in Bio-informatica toepassingen

21 Internet Packet switching ('60) Subsidie door ARPA (U.S Defense Department's Advanced Research Projects Agency). Techniek Opdeling data in kleine pakketjes met adres Pakketjes worden doorgegeven tussen verschillende gateways en routers tot ze hun bestemming bereiken Voordelen Verchillende datastromen kunnen 1 lijn delen Uitval van deel netwerk kan omzeild worden Gemakkelijke connectiviteit Toepassingen

22 Internet toepassingen Verschillende toepasingen oudste toepassing (nog altijd actueel) ftp: overbrengen van bestanden (~centrale naar server) telnet: werken op afstand (~commando's op server) Web Hyper text Verwijzingen/links in tekst naar andere teksten, figuren HTML: hyper text markup language URL: unified resource locator: protocol://hostname:port/path Client server Http: hyper text transfer protocol Integratie van andere protocols in de browsers ftp, gopher, Grafisch Eenvoudig te gebruiken Cross-platform, Open Dynamisch en interactief

23 Internet adressen Identificatie machines (hosts/servers) een 32 bit adres: 4 bytes, of 4 getallen (0-255) Netwerk en lokaal gedeelte (bv. Klasse A heeft eerste byte voor netwerk gedeelte Subnetting DNS (Domain Name System) hïerarchisch naamschema, gekend onder de naam 'domain naming scheme' bv..ua.ac.be,.com Overzetting tussen numerieke adressen en namen Gedistribueerd systeem, administratie per domain NAT (network address translation) Machines in subnetwerken die geen eigen internet adres krijgen, maar wel (beperkt) kunnen communiceren via een gateway die het locale netwerk verbindt met het Internet en de nodige omzettingen doet, bv. Meerder pcs thuis (router)

24 Network security Firewall Bescherming van interne netwerken Filtering van pakketten Op basis van herkomst, type,... Secure Socket Layers Encryptie van alle data connecties Toepassingen SSH (~ telnet) SFTP (~ ftp) Https (~ http/web)

25 Belangrijke Bio-informatica sites NCBI (http://www.ncbi.nlm.nih.gov/) National center for Biotechnology Information Amerikaans centrum voor bio-data en bio-informatica EBI (http://www.ebi.ac.uk/) European Bioinformatics Institute Europese tegenhanger NCBI EMBnet (http://www.embnet.org/) service sites in Europe Belgische node (http://www.be.embnet.org/) ExPASy (http://www.expasy.org/) Expert Protein Analysis System

Zelftest Java concepten

Zelftest Java concepten Zelftest Java concepten Document: n0838test.fm 22/03/2012 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INLEIDING BIJ DE ZELFTEST JAVA CONCEPTEN Om de voorkennis nodig

Nadere informatie

Web building basis: HTML. Karel Nijs 2008/09

Web building basis: HTML. Karel Nijs 2008/09 Web building basis: HTML Karel Nijs 2008/09 Web building basis eerste les HTML intro Browsers HTML elementen HTML basis tags HTML attributen HTML kleuren HTML formattering Extra: HTML entities Web building

Nadere informatie

Zelftest Informatica-terminologie

Zelftest Informatica-terminologie Zelftest Informatica-terminologie Document: n0947test.fm 01/07/2015 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INTRODUCTIE Deze test is een zelf-test, waarmee u

Nadere informatie

Module I - Soorten Netten

Module I - Soorten Netten Module I - Soorten Netten Wanneer we spreken over de verspreiding van informatie via IP netwerken en de bereikbaarheid van deze gegevens, dan kunnen we de netwerken onderverdelen in drie belangrijke soorten.

Nadere informatie

icafe Project Joeri Verdeyen Stefaan De Spiegeleer Ben Naim Tanfous

icafe Project Joeri Verdeyen Stefaan De Spiegeleer Ben Naim Tanfous icafe Project Joeri Verdeyen Stefaan De Spiegeleer Ben Naim Tanfous 2006-2007 Inhoudsopgave 1 2 1.1 Programmeertaal PHP5..................... 2 1.2 MySQL database......................... 3 1.3 Adobe Flash...........................

Nadere informatie

Waarmaken van Leibniz s droom

Waarmaken van Leibniz s droom Waarmaken van Leibniz s droom Artificiële intelligentie Communicatie & internet Operating system Economie Computatietheorie & Software Efficiënt productieproces Hardware architectuur Electronica: relais

Nadere informatie

Powerpoint presentatie College 5 Gilbert van Lierop & Farshad Salamat

Powerpoint presentatie College 5 Gilbert van Lierop & Farshad Salamat Powerpoint presentatie College 5 Gilbert van Lierop & Farshad Salamat Wat is een database? Een verzameling van georganiseerde data Een database bestaat uit applicaties, SQL en het DBMS Watis eendbms? EenDBMS

Nadere informatie

4Passief: n Afluisteren. n Geen gegevens gewijzigd of vernietigd. n Via de routers van WAN. n Via draadloze verbindingen. 4Fysieke afsluiting

4Passief: n Afluisteren. n Geen gegevens gewijzigd of vernietigd. n Via de routers van WAN. n Via draadloze verbindingen. 4Fysieke afsluiting Telematica Hoofdstuk 20 4Passief: n Afluisteren Bedreigingen n Alleen gegevens (inclusief passwords) opgenomen n Geen gegevens gewijzigd of vernietigd n Op LAN kan elk station alle boodschappen ontvangen

Nadere informatie

Chapter 4. eenvoudige webserver opzetten

Chapter 4. eenvoudige webserver opzetten Chapter 4. eenvoudige webserver opzetten Table of Contents 4.1. overzicht... 44 4.2. software beheren op Linux... 44 4.3. vi... 45 4.4. html... 45 4.5. apache2... 45 4.6. twee extra websites op de apache

Nadere informatie

1.Noem de vijf categorieën waarin programmeertalen kunnen worden ingedeeld en geef van elke categorie één voorbeeld.

1.Noem de vijf categorieën waarin programmeertalen kunnen worden ingedeeld en geef van elke categorie één voorbeeld. Module 4 programmeren 1.Noem de vijf categorieën waarin programmeertalen kunnen worden ingedeeld en geef van elke categorie één voorbeeld. Machinecode Assembleertalen: assembly Hogere programmeertalen:

Nadere informatie

Browser Programma om op een netwerk informatie te zoeken, bekijken en beheren. Voorbeeld: Internet Explorer, FireFox, Safari (Mac)

Browser Programma om op een netwerk informatie te zoeken, bekijken en beheren. Voorbeeld: Internet Explorer, FireFox, Safari (Mac) Leer voor de toets de onderstaande begrippen die te maken hebben met internet. Begrippen die te maken hebben met de computer zelf (de hardware) moet je ook leren. Je vindt deze begrippen in de Powerpointpresentatie

Nadere informatie

De 3 bovenstaande worden onderhouden door mensen beheerd Dus meer kwaliteit dan machine

De 3 bovenstaande worden onderhouden door mensen beheerd Dus meer kwaliteit dan machine Internet Sheet 1 Goed zoeken - Wat, waar en hoe je moet zoeken Startpagina's - Verzamel pagina en woord onderhouden door personen. ( Redactueren ) Direcotries - Is een verzamelen pagina met structuur doormiddel

Nadere informatie

NVU work shop. Kees Moerman http://www.keesmoerman.nl November 2006. 1. Overzicht van een web site. Wat is een web site HTML files

NVU work shop. Kees Moerman http://www.keesmoerman.nl November 2006. 1. Overzicht van een web site. Wat is een web site HTML files NVU work shop Moerman http://www.keesmoerman.nl November 2006 1 1 Overzicht 1. Overzicht van een web site Wat is een web site HTML files 2. NVU: Een HTML editor Overzicht Een eerste pagina Configuratie

Nadere informatie

Module I - Informatica

Module I - Informatica Module I - Informatica 1) Iemand wilt een nieuwe auto aanschaffen. Gezien de gestegen brandstofprijzen wil de persoon een auto, die zuinig in brandstofgebruik is. Maak duidelijk hoe de persoon een weloverwogen

Nadere informatie

Erik Poll Martijn Warnier. http://www.cs.kun.nl/~erikpoll/linux

Erik Poll Martijn Warnier. http://www.cs.kun.nl/~erikpoll/linux Introductie Linux/UNIX Erik Poll Martijn Warnier http://www.cs.kun.nl/~erikpoll/linux Concrete doel van vandaag Basisvaardigheden UNIX/Linux werken met de command line shell file beheer proces beheer Betere

Nadere informatie

Temperatuur logger synchronisatie

Temperatuur logger synchronisatie Temperatuur logger synchronisatie Juni 10, 2010 1 / 7 Temperatuur logger synchronisatie Introductie Twee of meerdere ontvangers van het Multilogger systeem kunnen met de temperature logger synchronisatie

Nadere informatie

Nederlands WMS - SLD Profiel. Versie 1.0

Nederlands WMS - SLD Profiel. Versie 1.0 Nederlands WMS - SLD Profiel Versie 1.0 Ravi: een profiel Ravi, netwerk voor geo-informatie Stichting Ravi is een netwerkorganisatie in het publieke domein en richt zich op de ruimtelijke ontwikkeling

Nadere informatie

Dynamische websites met PHP (basis) Karel Nijs 2010/09

Dynamische websites met PHP (basis) Karel Nijs 2010/09 Dynamische websites met PHP (basis) Karel Nijs 2010/09 Leswijze Eerst wat theorie Begeleid met (korte) oefeningen Editor = UltraEdit Geen DreamWeaver Browser = Internet Explorer Vereiste voorkennis: (X)HTML

Nadere informatie

Programmeren: Visual Basic

Programmeren: Visual Basic PETERSTUYVESANT COLLEGE INFORMATICA 2009-2010 Programmeren: Visual Basic Algemene Kennis: 01. Programmeren Programmeren is het schrijven van een computerprogramma, een concrete verzameling instructies

Nadere informatie

Aandachtspunten voor installatie suse in vmware server

Aandachtspunten voor installatie suse in vmware server Aandachtspunten voor installatie suse in vmware server Voorbereiden van vware virtueel machine: 1. Select linux Suse linux 2. Maak disksize 5Gb Denk er als je virtual machine wilt draaien op FAT32 vink

Nadere informatie

Les C-04 Programmeren

Les C-04 Programmeren Les C-04 Programmeren 4.1 Programmeertalen In les B-03 is uitgelegd hoe de processor van een moderne computer geprogrammeerd dient te worden: programmacode wordt omgezet in assemblercode, die vervolgens

Nadere informatie

Communications and Networking: An Introduction

Communications and Networking: An Introduction Communications and Networking: An Introduction Hoofdstuk 7 Internet Application Layer Protocols 1. a) Op het moment van schrijven:.eu (Europese Unie). b) B.v.:.au (Australië),.at (Oostenrijk > Austria)

Nadere informatie

Documenten in en uit Apex

Documenten in en uit Apex Documenten in en uit Apex Hoe om te gaan met documenten en Oracle Apex Dick Dral, Detora Even voorstellen Oracle sinds 1988 (Ministerie van LNV) HTML sinds 1995 Oracle Webtoolkit sinds 1998 Apex sinds

Nadere informatie

ipact Installatiehandleiding CopperJet 816-2P / 1616-2P Router

ipact Installatiehandleiding CopperJet 816-2P / 1616-2P Router ipact Installatiehandleiding CopperJet 816-2P / 1616-2P Router Stap 1: Het instellen van uw computer Instellen netwerkkaart om de modem te kunnen bereiken: Windows 98/ME: Ga naar Start Instellingen Configuratiescherm

Nadere informatie

The OSI Reference Model

The OSI Reference Model Telematica Applicatielaag Hoofdstuk 16, 17 Applicatielaag 4Bevat alle toepassingen die van het netwerk gebruik maken n E-mail n Elektronisch nieuws n WWW n EDI (Electronic Data Interchange) n Napster,

Nadere informatie

Software 1. Basis HTML. bachelor grafische en digitale media cross-media ontwerp & grafimediatechnologie academiejaar 2009-2010 semester 1

Software 1. Basis HTML. bachelor grafische en digitale media cross-media ontwerp & grafimediatechnologie academiejaar 2009-2010 semester 1 Software 1 Basis HTML bachelor grafische en digitale media cross-media ontwerp & grafimediatechnologie academiejaar 2009-2010 semester 1 Alain Simons alain.simons@artesis.be Basis HTML 1. Introductie 2.

Nadere informatie

Computernetwerken Deel 2

Computernetwerken Deel 2 Computernetwerken Deel 2 Beveiliging Firewall: toegang beperken IDS: inbraak detecteren en alarmeren Encryp>e: gegevens verbergen Firewall Waarom? Filteren van pakkeben Wildcard mask: omgekeerd subnetmasker

Nadere informatie

NAT (Network Address Translation)

NAT (Network Address Translation) Technical Note #019 Auteur: Olaf Suchorski Gemaakt op: 11 juli 2000 Bijgewerkt op: 11 juli 2000 NAT (Network Address Translation) In deze Technical Note worden de meest voorkomende situaties met NAT doorgelicht.

Nadere informatie

Les 11: systeemarchitectuur virtuele machines

Les 11: systeemarchitectuur virtuele machines Les 11: systeemarchitectuur virtuele machines Geavanceerde computerarchitectuur Lieven Eeckhout Academiejaar 2008-2009 Universiteit Gent Virtuele machines Motivatie Interfaces Virtualisatie: inleiding

Nadere informatie

Is uw bestuur klaar voor IPv6? Shopt IT Antwerpen 25 april 2013

Is uw bestuur klaar voor IPv6? Shopt IT Antwerpen 25 april 2013 Is uw bestuur klaar voor IPv6? Shopt IT Antwerpen 25 april 2013 Fedict 2013. All rights reserved Agenda Fedict 2013. All rights reserved Agenda Wat is IPv4 / IPv6? Waarom is IPv6 nodig? Wie gebruikt al

Nadere informatie

Deel II Introductie Webdesign. Hoorcollege IUW Thema Webdesign 10 november 2014 Christof van Nimwegen

Deel II Introductie Webdesign. Hoorcollege IUW Thema Webdesign 10 november 2014 Christof van Nimwegen Deel II Introductie Webdesign Hoorcollege IUW Thema Webdesign 10 november 2014 Christof van Nimwegen Waarom Webdesign in IUW Het WWW is een schitterend voorbeeld van een platform voor informatie uitwisseling

Nadere informatie

Internet. Wat is het internet? initiatie. Senioren K.U.Leuven. Computers die met elkaar verbonden zijn, elkaar kunnen verstaan, dezelfde taal spreken,

Internet. Wat is het internet? initiatie. Senioren K.U.Leuven. Computers die met elkaar verbonden zijn, elkaar kunnen verstaan, dezelfde taal spreken, Internet initiatie Senioren K.U.Leuven maart 2008 ICT-Kantoor Dienst Administratieve informatieverwerking Wat is het internet? Computers die met elkaar verbonden zijn, elkaar kunnen verstaan, dezelfde

Nadere informatie

Zelftest Internet concepten en technieken

Zelftest Internet concepten en technieken Zelftest Internet concepten en technieken Document: n0832test.fm 10/02/2010 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INTRODUCTIE ZELFTEST INTERNET CONCEPTEN EN

Nadere informatie

in1671 - Operating System Concepten

in1671 - Operating System Concepten in1671 - Operating System Concepten drs J.W.J. Heijnsdijk Faculteit EWI, kamer 09.280 (Mekelweg 4) tel. 85804 email: Heijnsdijk@ewi.tudelft.nl 2005 1-1 Doel van een Operating System Wat is een Operating

Nadere informatie

in1671 - Operating System Concepten Doel van een Operating System Interrupts 3-Lagen model spooling (Simultaneous Peripheral Operation On Line)

in1671 - Operating System Concepten Doel van een Operating System Interrupts 3-Lagen model spooling (Simultaneous Peripheral Operation On Line) in1671 - Operating System Concepten Doel van een Operating System drs J.W.J. Heijnsdijk Faculteit EWI, kamer 09.280 (Mekelweg 4) tel. 85804 email: Heijnsdijk@ewi.tudelft.nl Wat is een Operating System?

Nadere informatie

Linux. Linux lezing 13 april 2005 Marcel Nijenhof Note: De slechste vragen zijn niet gestelde vragen

Linux. Linux lezing 13 april 2005 Marcel Nijenhof <marceln@xs4all.nl> Note: De slechste vragen zijn niet gestelde vragen Linux Linux lezing 13 april 2005 Marcel Nijenhof Note: De slechste vragen zijn niet gestelde vragen Indeling Inleiding Overeenkomsten Verschillen Opbouw Toepassen distributies opensource

Nadere informatie

Programmeren in C ++ met wxwidgets les 5

Programmeren in C ++ met wxwidgets les 5 Elektrotechniek/Embedded Systems engineering inf2d Programmeren in C ++ met wxwidgets les 5 cursus 2009-2010 ir drs E.J Boks Les 5 Grafische toolkits Basisbeginselen gebruik grafische toolkit WxWidgets

Nadere informatie

TEST JE WEBKENNIS: Smarty or dummy www.blaucapel.nl >vakken> informatiekunde> test je webkennis

TEST JE WEBKENNIS: Smarty or dummy www.blaucapel.nl >vakken> informatiekunde> test je webkennis TEST JE WEBKENNIS: Smarty or dummy www.blaucapel.nl >vakken> informatiekunde> test je webkennis Deelnemen? Opdracht Voorbeeld : combineer de eerste kolom met de tweede. : 1 = B of 2 = LL (dit zijn niet

Nadere informatie

Communicatienetwerken

Communicatienetwerken Communicatienetwerken Oefeningen 4 : ALGEMEEN (niet voor MTI) Woensdag 2 december 2009 1 VRAAG 1 : MAC/IP adressen toekennen 2 VRAAG 1 : MAC/IP adressen toekennen Scenario Link 1 Link 2 Link 3 Link 4 Link

Nadere informatie

Peelland ICT Online Back-up

Peelland ICT Online Back-up Peelland ICT Online Back-up Peelland ICT biedt volledig in eigen beheer online back-up aan. Hiermee voorzien wij onze klanten van de laatste nieuwe back-up mogelijkheden en technieken. Risico s conventionele

Nadere informatie

Thinking of development

Thinking of development Thinking of development Netwerken en APIs Arjan Scherpenisse HKU / Miraclethings Thinking of Development, semester II 2012/2013 Agenda voor vandaag Netwerken Protocollen API's Opdracht Thinking of Development,

Nadere informatie

Bijlage D. Binair rekenen

Bijlage D. Binair rekenen Bijlage D Binair rekenen Bits, bytes en computerwoorden Alle huidige computersystemen zijn gebaseerd op digitale logica. Elk geheugenelement kent een geladen en een niet-geladen positie. Vaak wordt dit

Nadere informatie

Zelftest XML Concepten

Zelftest XML Concepten Zelftest XML Concepten Document: n1035test.fm 18/02/2010 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INLEIDING Om een idee te hebben van wat we verwachten als voorkennis

Nadere informatie

Zope. Een technische introductie. Martijn Pieters Antraciet BV mj@antraciet.nl. V1.2-26 september 1999

Zope. Een technische introductie. Martijn Pieters Antraciet BV mj@antraciet.nl. V1.2-26 september 1999 Een technische introductie Zope Martijn Pieters Antraciet BV mj@antraciet.nl V1.2-26 september 1999 Kerkstraat 19 Postbus 256 1400 AG Bussum The Netherlands e info@antraciet.nl t +31 (0)35 625 4545 f +31

Nadere informatie

Infosessie Systeembeheerders. 26 juni 2002. VPN aan de KULeuven

Infosessie Systeembeheerders. 26 juni 2002. VPN aan de KULeuven Infosessie Systeembeheerders VPN aan de KULeuven Doel (1) vertrouwelijke informatie ter beschikking stellen van 'KUL-vreemde' netwerken thuiswerkers mobiele gebruikers externe contracten kotnet constante

Nadere informatie

1 Client/Server. 2 Geschiedenis. 3 Toekomst

1 Client/Server. 2 Geschiedenis. 3 Toekomst Deel 1 Inleiding 1 Client/Server 2 Geschiedenis 3 Toekomst Het client-server model is een model voor de samenwerking tussen twee of meer programma's, die zich op verschillende computers kunnen bevinden.

Nadere informatie

Programmeren. Inleiding

Programmeren. Inleiding Programmeren Inleiding STAPPEN IN DE ONTWIKKELING VAN EEN PROGRAMMA 1. Probleem 1. Probleem Ideaal gewicht berekenen Wortel van een vierkantsvergelijking berekenen Schaakspel spelen Boekhouding doen 2.

Nadere informatie

Pak de controle met VNC

Pak de controle met VNC Pak de controle met VNC Tijdens ons recentelijke SOACamp kwam ik er achter dat niet iedereen bekend is met het gemak van het overnemen van desktops en dan vooral hoe makkelijk het is. Vooral als je veel

Nadere informatie

Aan de slag met DNS Jeroen van Herwaarden, Robbert-Jan van Nugteren en Yannick Geerlings 19-3-2010

Aan de slag met DNS Jeroen van Herwaarden, Robbert-Jan van Nugteren en Yannick Geerlings 19-3-2010 Aan de slag met DNS Jeroen van Herwaarden, Robbert-Jan van Nugteren en Yannick Geerlings 19-3-2010 Inhoud Hoofdstuk 1 Inleiding... 3 Hoofdstuk 2 Algemene informatie over DNS... 4 Hoofdstuk 3 Verschillende

Nadere informatie

Analyse probleem remote execution

Analyse probleem remote execution Analyse probleem remote execution Karel Nijs 2005-09-28 1.1 Beschrijving van het project De bedoeling van de GUI is een gemakkelijke uitvoering van verschillende checks van ICs. De GUI moet in Tcl/Tk ontworpen

Nadere informatie

Revisie geschiedenis. [XXTER & KNX via IP]

Revisie geschiedenis. [XXTER & KNX via IP] Revisie geschiedenis [XXTER & KNX via IP] Auteur: Freddy Van Geel Verbinding maken met xxter via internet met de KNX bus, voor programmeren of visualiseren en sturen. Gemakkelijk, maar niet zo eenvoudig!

Nadere informatie

Programmeren in Java

Programmeren in Java 4 september 2015 Even voorstellen Naam: Wessel Oele(39) Email: W.Oele@hr.nl Website: http://med.hro.nl/oelew Kop van Zuid Rotterdam, 3 juni 2007 Overzicht van modules programmeren in Java In totaal 4 modules

Nadere informatie

Welkom in de wondere wereld van websites met WordPress.

Welkom in de wondere wereld van websites met WordPress. Welkom in de wondere wereld van websites met WordPress. Alsjeblieft, dit kleine WordPress woordenboekje is voor jou. Want als je voor het eerst een website met WordPress gaat maken kom je misschien woorden

Nadere informatie

De volgende MTA s installeren in een groepje van 4 studenten: Onderzoek van vorig jaar naar gebruikte mail software evalueren.

De volgende MTA s installeren in een groepje van 4 studenten: Onderzoek van vorig jaar naar gebruikte mail software evalueren. Hoofdstuk 4 Mail Transfer Agents Email is een van de belangrijkste services die je als systeembeheer voor je gebruikers moet verzorgen. Als er geen mail verstuurd of ontvangen kan worden, kunnen de gebruikers

Nadere informatie

Security bij de European Registry for Internet Domain Names

Security bij de European Registry for Internet Domain Names Security bij de European Registry for Internet Domain Names Peter Janssen Technical Manager EURid vzw/asbl Computable Security Seminar 25/09/2008 Wie is EURid? Not for profit organisatie Naar Belgische

Nadere informatie

Tim Mallezie Architectuur van besturingssystemen: Vraag A2.

Tim Mallezie Architectuur van besturingssystemen: Vraag A2. Procesbeheer: kenmerken van moderne besturingssystemen. 1. Bespreek de (drie) meest typische kenmerken van moderne besturingssystemen. 2. In hoeverre beantwoorden UNIX, Linux en Windows NT hieraan? Geef

Nadere informatie

http://www.playgarden.com/ Hoofdstuk 1: Inleiding 7

http://www.playgarden.com/ Hoofdstuk 1: Inleiding 7 http://www.playgarden.com/ Hoofdstuk 1: Inleiding 7 1. Inleiding Je kan er vandaag niet meer langs kijken. Het internet bestaat, en dat zal geweten zijn. Je hoort in het nieuws iets over een virus dat

Nadere informatie

Netwerken. 6 januari 2014 David N. Jansen

Netwerken. 6 januari 2014 David N. Jansen Netwerken 6 januari 2014 David N. Jansen Huiswerkopdracht 2 donderdag 9 januari al inleveren! Leerstof voor vandaag. Stallings hoofdst 17 www.williamstallings.com /OS/OS6e.html M17_STAL6329_06_SE_C17.QXD

Nadere informatie

Selenium IDE Webdriver. Introductie

Selenium IDE Webdriver. Introductie Selenium IDE Webdriver Het Wielsem 10, 5231 BW s- Hertogenbosch, telefoon 073-6409311 e- mail info@testwork.nl internet http://www.testwork.nl 1 Inhoudsopgave 1 Inhoudsopgave... 2 2 Selenium IDE... 3 3

Nadere informatie

Remote Access. Of geven en nemen

Remote Access. Of geven en nemen Remote Access Of geven en nemen Remote access Zeer ruim begrip Voor alle doeleinden Geven en nemen ivm client-server Geven en nemen ivm security Heel veel servers ter beschikking en onder alle besturingssystemen

Nadere informatie

Practicum Netwerken CISCO: Deel 1. Philippe Dellaert

Practicum Netwerken CISCO: Deel 1. Philippe Dellaert Practicum Netwerken CISCO: Deel 1 Philippe Dellaert 17-03-2007 Hoofdstuk 1 Inleiding Dit is de oplossing die ik heb samen gesteld voor het eerste practicum van het vak Computernetwerken met de CISCO routers.

Nadere informatie

Tentamen Telematica Systemen en Toepassingen (261000) 3 november 2010, 8.45 12.15

Tentamen Telematica Systemen en Toepassingen (261000) 3 november 2010, 8.45 12.15 Page 1 of 14 Naam Initialen Studentnummer Studierichting Tentamen Telematica Systemen en Toepassingen (261000) 3 november 2010, 8.45 12.15 Opmerkingen: Alleen 1 dubbelzijdig blad met aantekeningen / samenvatting

Nadere informatie

1. inleiding. Dit werk is gelicenseerd onder een Creative Commons Naamsvermelding NietCommercieel GelijkDelen 3.0 Unported licentie

1. inleiding. Dit werk is gelicenseerd onder een Creative Commons Naamsvermelding NietCommercieel GelijkDelen 3.0 Unported licentie 1. inleiding Misschien zonder het te beseffen, maak je dagelijks gebruik van computernetwerken. Of je nu WhatsApp gebruikt om je vrienden een bericht te sturen of Google Chrome om iets op te zoeken, je

Nadere informatie

Van dvd naar webserver. Marcel Nijenhof Marceln@pion.xs4all.nl 18 Juli 2006 http://pion.xs4all.nl/lezingen/centos.pdf

Van dvd naar webserver. Marcel Nijenhof Marceln@pion.xs4all.nl 18 Juli 2006 http://pion.xs4all.nl/lezingen/centos.pdf Van dvd naar webserver Marcel Nijenhof Marceln@pion.xs4all.nl 18 Juli 2006 http://pion.xs4all.nl/lezingen/centos.pdf 1 Indeling Start installatie Wat is linux Wat zijn distributies Geschikte distributies

Nadere informatie

Een webserver bereikbaar maken voor IPv6

Een webserver bereikbaar maken voor IPv6 Een webserver bereikbaar maken voor IPv6 Handleiding Auteur(s): Jan Michielsen (SURFnet) Versie: 1.1 Datum: maart 2012 SURFnet bv Radboudkwartier 273 Postbus 19035, 3501 DA Utrecht T 030-2 305 305 F 030-2

Nadere informatie

icafe Een digitaal bestelsysteem voor de horeca Joeri Verdeyen Stefaan De Spiegeleer Naim Ben Tanfous

icafe Een digitaal bestelsysteem voor de horeca Joeri Verdeyen Stefaan De Spiegeleer Naim Ben Tanfous icafe Een digitaal bestelsysteem voor de horeca Joeri Verdeyen Stefaan De Spiegeleer Naim Ben Tanfous 2006-2007 Voorwoord 1 Inhoudsopgave 2 Hoofdstuk 1 Inleiding 3 Hoofdstuk 2 icafe 2.1 Het idee 2.2 Mogelijkheden

Nadere informatie

Software hoofdstuk 1. 1. Wat is de functie van een besturingssysteem? 2. Welke hoofdtaken heeft het besturingssysteem?

Software hoofdstuk 1. 1. Wat is de functie van een besturingssysteem? 2. Welke hoofdtaken heeft het besturingssysteem? Software hoofdstuk 1 1. Wat is de functie van een besturingssysteem? Een besturingssysteem ( in het Engels operating system of afgekort OS) is een programma (meestal een geheel van samenwerkende programma's)

Nadere informatie

Bestandssystemen. yvan vander sanden. 16 maart 2015

Bestandssystemen. yvan vander sanden. 16 maart 2015 Bestandssystemen yvan vander sanden 16 maart 2015 Bij elk operating system is het belangrijk te begrijpen hoe schijven en bestandssystemen werken. Schijven moeten geformatteerd worden met een specifiek

Nadere informatie

computernetwerken F. Vonk versie 4 21-11-2015

computernetwerken F. Vonk versie 4 21-11-2015 2015 computernetwerken F. Vonk versie 4 21-11-2015 inhoudsopgave 1. inleiding... - 2-2. datacommunicatie... - 3-3. het TCP/IP model... - 6-4. protocollen... - 8-5. computernetwerken... - 15-6. netwerkapparatuur...

Nadere informatie

DrICTVoip.dll v 2.1 Informatie en handleiding

DrICTVoip.dll v 2.1 Informatie en handleiding DrICTVoip.dll v 2.1 Informatie en handleiding Nieuw in deze versie : Koppeling voor web gebaseerde toepassingen (DrICTVoIPwebClient.exe) (zie hoofdstuk 8) 1. Inleiding Met de DrICTVoIP.DLL maakt u uw software

Nadere informatie

MxStream & Linux. Auteur: Bas Datum: 7 november 2001

MxStream & Linux. Auteur: Bas Datum: 7 november 2001 MxStream & Linux Auteur: Bas Datum: 7 november 2001 Gebruikte bronnen http://www.weethet.nl/dutch/adsl_mxstream_alcatelhack.asp http://www.bruring.com/adsl/article.php?sid=6 http://security.sdsc.edu/self-help/alcatel/challenge.cgi

Nadere informatie

Prijslijst 2015. Algemeen. Reparaties. Installaties. Voorrijkosten binnen gemeente Bedum: 5,- Voorrijkosten buiten gemeente Bedum: 20,-

Prijslijst 2015. Algemeen. Reparaties. Installaties. Voorrijkosten binnen gemeente Bedum: 5,- Voorrijkosten buiten gemeente Bedum: 20,- Prijslijst 2015 Algemeen Voorrijkosten binnen gemeente Bedum: 5,- Voorrijkosten buiten gemeente Bedum: 20,- Advisering: 10,- per uur. Reparaties Onderzoekskosten: 10,- Reparatiekosten: 10,- Installaties

Nadere informatie

Virtual Web mini-howto

Virtual Web mini-howto Dan Pancamo Parag Mehta pm@gnuos.org Vertaald door: Ellen Bokhorst In deze HOWTO wordt het opzetten van een Virtuele Web Site onder Linux besproken. Inhoudsopgave 1. Licentie...1 2. Wat is een Virtuele

Nadere informatie

OPDRACHTKAART. Thema: Multimedia. Het internet 3. Het World Wide Web MM-05-03-01. Voorkennis: Geen.

OPDRACHTKAART. Thema: Multimedia. Het internet 3. Het World Wide Web MM-05-03-01. Voorkennis: Geen. OPDRACHTKAART MM-05-03-01 Het World Wide Web Voorkennis: Geen. Intro: Deze opdracht gaat over de belangrijkste mogelijkheid van het internet: het surfen op het World Wide Web. Deze opdracht beschrijft

Nadere informatie

Welcome to hyperspace...

Welcome to hyperspace... Welcome to hyperspace... inleiding met uitleg internetjargon voorbeeld case webshop de wereld van Google hoe om te gaan met wachtwoorden webbrowserperikelen (= scrabble woord) optionele staande ovatie

Nadere informatie

1945, eerste DC. Eigen logo

1945, eerste DC. Eigen logo 1945, eerste DC Eigen logo Doelstelling: Binnen uw computer ruimte verzamelt u diverse informatie over bijvoorbeeld stroomverbruik van uw apparatuur. Via welk netwerk kunt u deze data verwerken. Welk

Nadere informatie

Databases - Inleiding

Databases - Inleiding Databases Databases - Inleiding Een database is een verzameling van een aantal gegevens over een bepaald onderwerp: een ledenbestand van een vereniging, een forum, login gegevens. In een database worden

Nadere informatie

De mogelijkheden van XML voor de langdurige bewaring van digitale documenten. DAVID studiedag 30 nov 2000

De mogelijkheden van XML voor de langdurige bewaring van digitale documenten. DAVID studiedag 30 nov 2000 De mogelijkheden van XML voor de langdurige bewaring van digitale documenten DAVID studiedag 30 nov 2000 Prof. Jan Engelen, Steven Depuydt K.U.Leuven - ESAT Onderzoeksgroep Document Architecturen Waarom

Nadere informatie

Flex_Rooster WERKBOEK. INTRODUCTIE iseries. Dit werkboek is eigendom van ICS opleidingen en mag niet worden meegenomen.

Flex_Rooster WERKBOEK. INTRODUCTIE iseries. Dit werkboek is eigendom van ICS opleidingen en mag niet worden meegenomen. Flex_Rooster WERKBOEK INTRODUCTIE iseries Dit werkboek is eigendom van ICS opleidingen en mag niet worden meegenomen. ICS Opleidingen Niets uit deze uitgave mag worden verveelvoudigd en/of openbaar gemaakt

Nadere informatie

Web Application Security Hacking Your Way In! Peter Schuler & Julien Rentrop

Web Application Security Hacking Your Way In! Peter Schuler & Julien Rentrop Web Application Security Hacking Your Way In! Peter Schuler & Julien Rentrop 1 Agenda Injection Cross Site Scripting Session Hijacking Cross Site Request Forgery #1 OWASP #2 top 10 #3 #5 Bezoek www.owasp.org

Nadere informatie

Hoofdstuk 15. Computernetwerken

Hoofdstuk 15. Computernetwerken Hoofdstuk 15 Computernetwerken 1 Figuur 15.1 Bustopologie Figuur 15.2 Stertopologie Figuur 15.3 Ringtopologie isolatie kern afscherming Figuur 15.4 Coaxkabel Figuur 15.5 Tweeaderige UTP Coating Core Cladding

Nadere informatie

Laten we eens beginnen met de mouwen op te stropen en een netwerk te bouwen.

Laten we eens beginnen met de mouwen op te stropen en een netwerk te bouwen. Practicum Filius In deze proefles gaan we jullie kennis laten maken met computernetwerken. Na afloop van dit practicum heb je een goede basis van waar een netwerk uit kan bestaan, hoe je een netwerk bouwt

Nadere informatie

Computernetwerken! E-mail: SMTP Simple Mail Transfer Protocol, POP Post Ofice Procotol

Computernetwerken! E-mail: SMTP Simple Mail Transfer Protocol, POP Post Ofice Procotol Computernetwerken 1. Fundamentals Communicatie vereist regels, deze regels noemt met protocollen. Mensen kunnen met relatief losse regels (protocollen) communiceren, bij computers moet dit strikt vastliggen.

Nadere informatie

Oracle Application Server Portal Oracle Gebruikersgroep Holland Oktober 2003

Oracle Application Server Portal Oracle Gebruikersgroep Holland Oktober 2003 Oracle Application Server Portal Oracle Gebruikersgroep Holland Oktober 2003 Page 1 1 Kees Vianen Senior Sales Consultant Technology Solutions Oracle Nederland Agenda Geschiedenis van Oracle Portal Portal

Nadere informatie

MSSL Dienstbeschrijving

MSSL Dienstbeschrijving MSSL Dienstbeschrijving Versie : 1.0 Datum : 28 augustus 2007 Auteur : MH/ME Pagina 2 van 7 Inhoudsopgave Inhoudsopgave... Fout! Bladwijzer niet gedefinieerd. Introductie... 3 Divinet.nl Mssl... 3 Hoe

Nadere informatie

Leza biedt gebruikers de mogelijkheid om pc s, laptops en servers te back-uppen en back-ups te herstellen.

Leza biedt gebruikers de mogelijkheid om pc s, laptops en servers te back-uppen en back-ups te herstellen. LEZA ONLINE BACKUP Servicedefinitie 1. Data-encryptie 2. Beveiligde internetverbinding 3. Datacenter 4. Recovery 5. Richtlijnen reactietijden & bereikbaarheid 6. Controle Back-up 7. Onderhoudswerkzaamheden

Nadere informatie

HTML. Media. Hans Roeyen V 3.0

HTML. Media. Hans Roeyen V 3.0 Media Hans Roeyen V 3.0 12 maart 2015 Inhoud 1. (Multi)Media op websites... 3 2. Flash en Websites... 4 3. Video op je website... 4 3.1. YouTube insluiten op de pagina... 4 3.2. Video zonder YouTube...

Nadere informatie

Installatiegids Registratie Hardware specificaties

Installatiegids Registratie Hardware specificaties Installatiegids Installatiegids... 1 Registratie... 2 Hardware specificaties... 3 Waarschuwing ivm Poorten die open moeten staan... 3 Configuratie voor gebruik op Citrix, Terminal Server,...... 4 Windows

Nadere informatie

Data Acquisitie in een modern jasje. Wordt het de tablet of toch iets anders?

Data Acquisitie in een modern jasje. Wordt het de tablet of toch iets anders? Data Acquisitie in een modern jasje. Wordt het de tablet of toch iets anders? Marco Bischoff Yokogawa Europe BV 7 november 2013 Yokogawa IA Control Products --- Business domain Technologischeontwikkelingen

Nadere informatie

IPv6 @ NGN. Wageningen, 30 oktober 2008. Iljitsch van Beijnum

IPv6 @ NGN. Wageningen, 30 oktober 2008. Iljitsch van Beijnum IPv6 @ NGN Wageningen, 30 oktober 2008 Iljitsch van Beijnum Blok 3+4: Routering & adressering When is the tube empty? HD ratio: in hierarchical system never possible to use every single address: HD = log(addresses

Nadere informatie

Extra uitleg bij installatie EPB-software 3G

Extra uitleg bij installatie EPB-software 3G Extra uitleg bij installatie EPB-software 3G Inhoud VOORWOORD... 2. INSTALLEREN... 2. Systeemvereisten... 2.2 Softwarecompatibiliteit... 2 2. VAAK VOORKOMENDE PROBLEMEN... 2 2. Installatie- of opstartproblemen...

Nadere informatie

De SAP Cloud Connector 2.0 maakt SAPUI5 ontwikkeling via de WEB-IDE mogelijk met data uit je eigen backend systeem.

De SAP Cloud Connector 2.0 maakt SAPUI5 ontwikkeling via de WEB-IDE mogelijk met data uit je eigen backend systeem. De SAP Cloud Connector 2.0 maakt SAPUI5 ontwikkeling via de WEB-IDE mogelijk met data uit je eigen backend systeem. Vele van ons willen wel eens spelen met de WEB-IDE in de could via het SAP Trial Hana

Nadere informatie

XML Datafeeds. Volledig geautomatiseerd advertenties plaatsen V 2.3 1-5-2014

XML Datafeeds. Volledig geautomatiseerd advertenties plaatsen V 2.3 1-5-2014 XML Datafeeds Volledig geautomatiseerd advertenties plaatsen V 2.3 1-5-2014 Dit document beschrijft de XML datafeed specificatie voor Pro Accounts van AdvertentiePlanet. 1 AdvertentiePlanet is een onderdeel

Nadere informatie

Hoofdstuk 2. - is verantwoordelijk voor de communicatie van de software met de hardware.

Hoofdstuk 2. - is verantwoordelijk voor de communicatie van de software met de hardware. Hoofdstuk 2 2.1 systeembeheerprogramma s Werking en functies van besturingssystemen Besturingssysteem/operating systeem(os) - is verantwoordelijk voor de communicatie van de software met de hardware. -

Nadere informatie

Vakgroep CW KAHO Sint-Lieven

Vakgroep CW KAHO Sint-Lieven Vakgroep CW KAHO Sint-Lieven Objecten Programmeren voor de Sport: Een inleiding tot JAVA objecten Wetenschapsweek 20 November 2012 Tony Wauters en Tim Vermeulen tony.wauters@kahosl.be en tim.vermeulen@kahosl.be

Nadere informatie

INTERNET. Internetwerken, Fysiche architectuur, protocollen.

INTERNET. Internetwerken, Fysiche architectuur, protocollen. INTERNET Deel I Internetwerken, Fysiche architectuur, protocollen. 1) Inleiding Internetwerk-technologie: om verscheidene fysische netwerken aan elkaar te koppelen tot 1 groot, uniform communicatiesysteem.

Nadere informatie