GELD ALS SCHULD. "Het proces waarmee banken geld creëren is zo simpel dat de geest het afstoot." John Kenneth Galbraith, Econoom

Maat: px
Weergave met pagina beginnen:

Download "GELD ALS SCHULD. "Het proces waarmee banken geld creëren is zo simpel dat de geest het afstoot." John Kenneth Galbraith, Econoom"


1 GELDALSSCHULD "EenaantalvandegrootstenamenindeVerenigdeStaten,indesectorenvan handelenproductie,zijnbangvooriets.zewetendatereenkrachtisergenszo georganiseerd,zosubtiel,zooplettend,zoverweven,zocompleet,zoverspreid,dat zebeternieteentegrotemondhebbenalszeerveroordelendoverspreken." WoodrowWilson,voormaligPresidentvandeVS "Iederekeeralseenbankeenleningafsluit,wordterbankkredietgecreëerd nieuwestortingen gloednieuwgeld." GrahamF.Towers,Gouverneur,BankvanCanada, "Hetproceswaarmeebankengeldcreëreniszosimpeldatdegeesthetafstoot." JohnKennethGalbraith,Econoom "Stamijtoeomhetgelduittegevenentebeheersenenikgeefernietsomwiede wettenmaakt." MayerAnselmRotschild,Bankier GeldalsSchuld Tweegrotemysteriesdominerenonzelevens,liefdeengeld. 'Watisliefde?',iseenvraagdieeindeloosbestudeerdisinverhalen,liederen, boeken,(ilmsentelevisie.maardatkannietwordengezegdoverdevraag,'watis geld?'. Hetisnietvreemddatmonetairetheorienietdeinspiratieisgeweestvan!ilmhits,maarhetwordtnieteensgenoemdindescholendiedemeestenvanons bezochten.voordemeestenroeptdevraag'waarkomtgeldvandaan?'eenbeeld opvandemuntdiebiljettendruktenmuntenslaat.geld,zodenkendemeesten, wordtgecreëerddoordeoverheid.datiswaar,maarslechtstotopzekerehoogte. Diemetalenenpapierensymbolenvanwaardediewenormaalzienalsgeld wordeninderdaadgemaaktdooreenoverheidsinstelling:demunt.maarhet overgrotedeelvanhetgeldwordtnietgecreëerddoordemunt.hetwordtiedere dag,inenormehoeveelheden,gecreëerddoorprivatecorporatiesdiewebanken noemen. Demeestendenkendatbankengelduitlenendathentoevertrouwdisdoor storters(houders).makkelijkomjevoortestellen,maarhetisnietdewaarheid. Bankencreërenhetgelddatzeuitlenennietuithaareigeninkomsten nietuit gestortgeld handtekeningvaneenleneropdeleenovereenkomstiseenverplichtingomde bankdeleningterugtebetalenplusrente,ofzeverliezenhunhuis,auto,ofwelk objectzealsonderpandgaven.datiseengroteverplichtingvoordelener. Watvereistdezelfdehandtekeningvandebank?Debankmaghetbedragvande leningcreërenenhetbijschrijvenopderekeningvandelener.letwel:creëren! Klinktdatvergezocht?Datkantochnietwaarzijn?Maardatishetwel. 1

2 Omuitteleggenhoeditwondervanmodernbankierenontstond,hieronderhet verhaalvandegoudsmid. HetVerhaalvandeGoudsmid Ooit,inverschillendetijden,werdvanallesgebruiktalsgeld.Hetmoest draagbaarzijnengenoegmensenmoesteneropvertrouwendathetlaterweer konwordeningewisseldvoordingenmetechtewaardealsvoedsel,kledingen behuizing.schelpen,cacaobonen,mooiestenen,zelfsverenzijngebruiktalsgeld. Goudenzilverwarenaantrekkelijkzachtenmakkelijkbewerkbaar,dussommige culturenwerdenbekwaammetdezematerialen.goudsmedenmaaktenhandel veelmakkelijkerdoormuntentegieten:gestandaardiseerdeeenhedenvandeze metalen,welksgewichtenzuiverheidwasgegarandeerd. Omzijngoudtebeschermenhaddegoudsmideenkluisnodig.Alsnelkloptenzijn dorpsgenotenaandedeuromruimtetehurenomhuneigenmuntenen kostbaarhedentebeschermen.zoverhuurdedegoudsmidineenmumvantijd iedereplankindekluisenverdiendehijeenkleininkomenmetzijn kluisverhuurbedrijf. Jarengingenvoorbijendegoudsmidbedachtietsslims.Houderskwamenzelden omhungoudwegtehalenenzekwamennooitallemaaltegelijk.datkwam omdatdereçu's,diedegoudsmiduitschreefalsontvangstbewijzenvoorhetgoud, verhandeldwerdenopdemarktalszijndehetgoudzelf.ditpapierengeldwas veelmakkelijkerdanzwaremunten.bedragenkondengewoonopgeschreven wordeninplaatsvanstukvoorstuktewordenuitgeteldvooriederetransactie. Degoudsmidbedachterdusnogeenanderehandelbij.Hijleendezijngouduiten rekenderente.maartoenzijnhandigereçugeldalgemeengeaccepteerdraakte begonnenlenersomleningentevragenindevormvandezereçu's,inplaatsvan hetdaadwerkelijkemetaal. Terwijldeindustriezichuitbreiddevroegenmeerenmeermensendegoudsmid omleningen.ditbrachthemopeennogbeteridee.hijwistdatmaarweinigvan zijnhoudershungelddaadwerkelijkophaalden.dusdegoudsmiddachtdathijer makkelijkmeewegzoukomenalshijreçu'suitschreefvoorhetgoudvanzijn houdersnaastzijneigengoud.zolangdeleningenwerdenterugbetaaldzouden zijnhoudersvannietswetenenerooknietslechtervanworden.degoudsmid,nu meerbankierdanhandwerksman,konzoveelmeerwinstmakendanhijzou kunnenalshijalleenzijneigengouduitleende. Jarenlangverdiendedegoudsmidinhetgeheimeengoedinkomenvanderente opandermansstortingen.alsprominentgeldschieterwerdhijalmaarrijkerdan zijndorpsgenotenenhijliepermeetekoop.verdenkingengroeidendathijhet geldvanzijnhoudersuitgaf.zijnhouderskwamensamenendreigdenhungoud tegenstellingtotwatjezoudenkenwerdditgeenrampvoordegoudsmid. 2

3 Ondanksdefrauduleuzeaardvanzijnsysteem,werktezijnidee.Dehouders warennietskwijtgeraakt.hungoudlagveiligindekluisvandegoudsmid.maar inplaatsvanhungoudterugtenemeneistendehoudersdatdegoudsmid,nuhun bankier,henlietmeepro$iterendoorheneendeelvanderentetebetalen. Datwashetbeginvanbankieren:Debankierbetaaldeeenlagerenteop stortingenvanandermansgeld,diehijdanuitleendetegeneenhogererente.het verschildektedekostenvandebankenhijmaaktenogwinstook.delogicavan ditsysteemissimpel.enhetlijkteenredelijkemanieromaandevraagnaar krediettevoldoen.echter,ditisniethoebankierentegenwoordigwerkt. Onzegoudsmidbankierwasniettevredenmethetinkomendatoverbleefnadat hijderente inkomstenhadgedeeldmetzijnstorters.ondertussengroeidede vraagnaarkredietsnelterwijldeeuropeanenzichverspreiddenoverdewereld. Maarzijnleningenwarenbeperktdoordehoeveelheidgouddiezijnhoudersin zijnkluishaddenliggen.toenkreeghijeennoggewaagderidee.omdatalleen hijzelfwistwaterdaadwerkelijkindekluislag,konhijreçu'suitschrijvenvoor gouddaterhelemaalnietwas.zolangnietallereçuhouderstegelijkertijdnaarde kluiskwamenomechtgoudteeisen,hoezouiemandhetdanweten?ditnieuwe planwerkteerggoed.debankierwerdongelofelijkrijkdoorderentediebetaald werdopgouddatnietbestond. Hetideedatdebankiergelduithetnietscreëerdewastewaanzinnigomte geloven.dusdezegedachtekwamlangetijdnietbijmensenop.maardemacht omgeldteverzinnensteegdebankiernaarhethoofd,zoalsjejekuntvoorstellen. Opeengegevenmomentwektedehoeveelheidleningenenzijnoverdadige rijkdomweerhetwantrouwenvandemensen.sommigelenerseistenechtgoud inplaatsvanpapierenvervangers.geruchtenverspreiddenzich.verschillende rijkehoudersverschenenomhungoudwegtehalen.hetspelwasover.eenzee vanreçuhoudersoverspoeldedestraatvoordegeslotenbank.debankierhad nietgenoeggoudenzilveromalhetpapiertedekkendathijhengegevenhad.dit wordteen'runopdebank'(bankrun)genoemd.hetiswatiederebankiervreest. Hetfenomeen'bankrun'ruïneerdeindividuelebankenenschaaddelogischerwijs hetpubliekevertrouweninallebankiers.hetzouvanzelfsprekendzijngeweest omsimpelwegteverbiedenomgelduithetnietstecreëren.maardegrote kredietendiedebankiersaanbodenwarenonmisbaargewordenvoorhetsucces vandeeuropesecommerciëleexpansie.duswerddezepraktijkgelegaliseerden gereguleerd.bankiersstemdeninomzichaanlimietentehoudenopde hoeveelheid)ictiefgelddatzekondenuitlenen.ditbedragwasnogsteedsveel groterdandedaadwerkelijkewaardevanhetgoudenzilverindekluis.meestal wasdeverhouding90ictievedollarstegen1echtedollaringoud.dezeregels werdengehandhaafddooronverwachtecontroles.erwerdookafgesprokendat inhetgevalvaneenbankrun,centralebankenlokalebankenzoudensteunenmet noodinjectiesvangoud.alleenalserrunsopveelbankentegelijkertijdwaren, zoudebankiers kredietbubbelbarstenenhetsysteeminstorten. 3

4 4 Hethuidigegeldsysteem Indeloopderjarenishetfractionelereservesysteemenhaargeïntegreerde netwerkvanbanken,ondersteunddooreencentralebank,hetdominante geldsysteemvandewereldgeworden.tegelijkertijdisdefractiegouddiehet schuldgelddektgestaaggekrompentotniets.debasisaardvangeldisveranderd. Geldvertegenwoordigdewaarde,nuvertegenwoordigthetschuld.Inhet verledenwaseenpapierendollareenreçudatkonwordeningewisseldvooreen vastehoeveelheidgoudofzilver.tegenwoordigkaneenpapierenofdigitale hetverledenbestondprivaatgecreëerdbankkredietalleenindevormvan privatebankbiljettendiemensenmochtenweigeren,netzoalswijvandaag iemandspersoonlijkechequemogenweigeren.tegenwoordigwordtprivaat gecreëerdbankkredietlegaalomgezetindoordeoverheiduitgegeven.iatvaluta: deusdollars,canadesedollarsenpondendiewenormaliterbeschouwenals geld.fiatvalutaisgelddatwordtgecreëerdmetoverheidsgoedkeuringofdecreet. Enwettigebetaalmiddelwettenbepalendatburgersdit#iatgeldmoeten accepterenalsa+betalingvoorschuld. Voordeduidelijkheidhierondereenbeschrijvingvanwatfractionele reservesystemenzijn,overgenomenvanwikipedia: Fractional reservebanking(fractioneelbankieren)ishetindehuidigebancairesectorbestaande gebruikwaarbijbankenslechtseendeelvandehuntoevertrouwdemiddelenindirectbeschikbarevorm aanhouden,enhetovergrotedeelvandemiddelenuitlenen,ongeachthunverplichtingomdehun toevertrouwdemiddelen,voorzoverdezedirectopeisbaarzijn,opeersteverzoekterugtebetalen. Hetgaathierbijomdedirectopvraagbaretegoeden(dusverplichtingenvandebank).Ditzijnin hoofdzaak: detegoedenvanrekeninghoudersinrekeningcourant(decreditsaldiopbetaalrekeningen) detegoedenopdirectopvraagbarespaarrekeningenvanrekeninghouders(dusnietdetegoedenop termijndeposito's) dedoordebankaangetrokkendaggeldleningen(leningendietussenbankenonderlingverstrekt wordenmeteenlooptijdvanslechtsééndag,voorbedragenvantientallentothonderdenmiljoenen euro's). Nuisdevraag,alsoverhedenenbankengewoongeldkunnenmaken,hoeveel geldbestaaterdan? Inhetverledenwerddetotalehoeveelheidgeldinomloopbeperktdoorde fysiekebeperkingopdatgenedatgebruiktwerdalsgeld.bijvoorbeeld,ommeer goud ofzilvergeldtecreërenmoestermeergoudofzilverwordengevondenen gedolven.tegenwoordigwordtgeldletterlijkgecreëerdalsschuld.nieuwgeld wordtgecreëerdzodraiemandeenleningneemtbijdebank.hetgevolgisdatde totalehoeveelheidgelddatgecreëerdkanwordenmaaréénechtebeperking heeft;detotalehoeveelheidschuld.(totaleamerikaanseschuldin1975was$5 triljoen,in2006washet$45triljoen(?).)

5 U.S. NATIONAL DEBT CLOCK The Outstanding Public Debt as of 30 Jan 2012 at 10:43:54 PM GMT is: The estimated population of the United States is 312,135,519 so each citizen's share of this debt is $48, The National Debt has continued to increase an average of $3.94 billion per day since September 28, 2007! Overhedenplaatseneenwettelijkelimietopdecreatievannieuwgelddoor regelstehandhaven:fractionelereservevereisten.dezefractionelereserve vereistenverschillenvanlandtotlandenvantijdtottijd.inhetverledenwashet eengebruikelijkevereistedatbankentenminsteééndollaraanechtgoudinde kluishaddenvooriederetiendollaraanschuldgelddatgecreëerdwerd. Tegenwoordigzijndereservevereistenverhoudingennietmeervantoepassing opdeverhoudingtussennieuwgeldengoudindekluis,maarslechtsopde verhoudingtussennieuwschuldgeldenbestaandschuldgelddatgestortisbijde hoeveelheiddoordeoverheiduitgegevencontanten,ofhetequivalentdatde bankheeftgestortbijdecentralebankplushetreedsbestaandeschuldgelddat debankinkasheeft. Omditopeeneenvoudigemanieruitteleggenstellenweonsvoordaterneteen nieuwebankisbegonnenennoggeenhoudersheeft.deinvesteerdershebben echtereenreservestortingbijdecentralebankgedaanvan$1111,12inbestaand contantgeld.devereistereserveverhoudingis9:1. Stap1:Debankopenthaardeurenenverwelkomthaareersteklantvooreen lening.hijheeft$10,000nodigvooreenauto.doorde9:1reserveverhouding magdenieuwebankdoorhaarreservebijdecentralebank,ookbekendals 'basisgeld',wettelijk9keerdatbedragcreëren,=$10,000opbasisvande schuldbeloftevandelener.deze$10,000wordtnergensvanafgenomen.hetis compleetnieuwgelddatsimpelwegopdelenersrekeningwordtingevoerdals bankkrediet.delenerschrijftdaneenchequeopdatbankkredietomdeautote kopen. Stap2:Deverkoopsterstortdezenieuwgecreëerde$10,000bijhaarbank.In tegenstellingtothetbasisgelddatgestortisbijdecentralebankmagditnieuw gecreëerdekredietgeldnietvermenigvuldigdwordenmetdereserveverhouding. 5

6 Hetwordtdaarentegengedeelddoordereserveverhouding.Meteenverhouding van9:1mageenleningvan$9.000gecreëerdwordenopbasisvandestorting van$10,000. Stap3:Alsdie$9,000wordtgestortdooreenderdepartijbijdezelfdebankdie hetcreëerdeofbijeenanderebank,danwordtditdewettigebasisvooreen derdeuitgiftevanbankkrediet.ditmaalvoorhetbedragvan$8,100.zoalseen matroesjkawaarbijiederelaageenietskleinerepopbinneninbevat,bevatiedere stortingdemogelijkheidvooreenietskleinereleningineenoneindigafnemende reeks.alshetgecreëerdeleengeldnietwordtgestortbijdebank,danstopthet proces.datishetonvoorspelbaredeelvanhetgeldcreatiemechanisme. Maarwaarschijnlijkwordtbijiederestaphetnieuwegeldwélgestortbijeen bank.enhetreserveverhoudingsproceskanzichkeeropkeerherhalentotdater bijna$100,000aangloednieuwgeldisgecreëerdbinnenhetbanksysteem.aldit geldisvollediggecreëerduitschuldenhetheleprocesiswettelijktoegestaan doordeeerstereservestortingvan$1111,12dienogsteedsonaangeroerdbijde centralebankliggen.bovendienmoetenonderditingenieuzesysteemde boekhoudingenvaniederebankindekettingtonendatdebank10%meeraan gestortgeldheeftdanhetuitheeftstaanalsleningen.ditgeeftbankeneensterke motiveringomstortingenteverkrijgenomzoleningentekunnenmaken, waarmeezedemisleidendemaaralgemeneindrukwekkendatleningenuitde stortingenkomen.tenzijalleopvolgendeleningenbijdezelfdebankworden gestortkunjenietzeggendateenindividuelebankhaaroriginele basisgeldreservebijna90keerheeftvermenigvuldigddoorbankkrediettegeven vanuithetniets.echter,hetbanksysteemiseengeslotenkring.hetbankkrediet vandeenebankwordteenstortingbijdeandereenviceversa.ineen theoretischewereldwaarinallesgelijkwordtuitgewisseldzouhetuiteindelijke resultaatprecieshetzelfdezijn,alsofhetheleprocesplaatsvondinéénbank.dat wilzeggendatdeoriginelecentralebankreservevandebankvanietsmeerdan$ 1100haartoestaatomuiteindelijkrenteteincasserenoptot$100,000diede banknooithad. BankenlenendusgelduitdatzeNIETHEBBEN! Ditklinktbelachelijk,maarhetwordtnogmooier. Indeafgelopentientallenjaren,alsgevolgvanhetlobbyendoordebanken,zijn devereistenomeenstortingtedoenbijdenationalecentralebankinsommige landenvrijwelverdwenen(insommigelandenisdecentralebankreserve Vereiste=$0)endedaadwerkelijkeverhoudingenkunnenveelhogerzijndan 9:1.Voorsommigetypenrekeningenzijnverhoudingenvan20:1tot30:1 gebruikelijk.enrecentelijk,doorgebruiktemakenvandossierkostenomde vereistereservevandelenerteverkrijgenhebbenbankennueenmanier gevondenomdebeperkingenopdereservevereistentotaalteomzeilen.dus, hoewelderegelsingewikkeldzijn,isderealiteitvoorhetgezondeverstand eigenlijkheelsimpel.bankenkunnenzoveelgeldcreërenalswijkunnenlenen. 6

7 Iedereenweetonbewustdatbankengeengelduitlenen.Alsjegeldopneemtvanje spaarrekeningverteltdebanknietdatdatnietkanomdatzijhetgeldheeft uitgeleendaaniemandanders. MarkMans(ield,EconoomenAuteur OndanksheteindeloosgepresenteerdebeeldmateriaalvandeMunt,beslaathet doordeoverheidgecreëerdegeldtypischslechtsminderdan5%vanhetgeldin omloop.meerdan95%vanalhetgelddatnubestaatwerdgecreëerddoor iemanddieeenschuldbekentenistekendeaaneenbank.daarnaastwordt bankkredietingrotehoeveelhedengecreëerdenvernietigd,iederedag,als nieuweleningenwordenafgeslotenenoudewordena0betaald. Ikbenbangdatdegewoneburgernietgraagzalhorendatbankenhungeld kunnencreërenendatookdoen....enzijdiehetkredietvaneenlandbeheersen,sturenhetbeleidvanregeringenen hebbenhetlotvandebevolkinginhunhanden. ReginaldMcKenna,voormaligVoorzitterMidlandsBankvanEngeland Bankenkunnenditgeldsysteemalleenuivoereninactievesamenwerkingmetde overheid: Teneerstenemenoverhedenwettigbetaalmiddelwettenaanomonsde nationale)iatvalutatelatengebruiken. Tentweedestaanoverhedenhettoedatprivaatbankkredietuitbetaaldwordt indezeoverheidsvaluta. Tenderdedwingenoverheidsrechtbankenschuldenaf. Tenslottevoerenoverhedenregelgevingendooromdefunctionaliteiten geloofwaardigheidvanhetgeldsysteemtewaarborgenvoorhetpubliek,terwijl zenietsdoenomhetpubliekteinformerenoverwaargelddaadwerkelijk vandaankomt. Desimpelewaarheidisdatwanneerwijtekenenopdestippellijnvaneen contractvooreenleningofhypotheek,onzeondertekendebetalingsbelofte ondersteunddoorhetonderpanddatweopgevenalswenietbetalen hetenige vanechtewaardeisindetransactie.vooriedereendiegelooftdatweonze beloftenakomenisdieleenovereenkomstofhypotheeknueendraagbaar, uitwisselbaarenverkoopbaarstukpapier.hetiseenschuldbekentenisdie waardevertegenwoordigtendaardooreenvormvangeldis.ditisgelddatde lenerinwisselttegendezogenaamdeleningvandebank.eenleningindeechte wereldbetekentdatdeuitlenerietstelenenmoethebben.alsjeeenhamernodig hebt,danismijnbeloftevooreenhamerdieikniethebnietechtbehulpzaam. Maarindekunstmatigewereldvangeldmageenbeloftevandebankomgeldte betalendathijnietheeftdoorgaanvoorechtgeld.enwijaccepterenhetals zodanig. 7

8 "Enzodoendeisonsnationaalcirculerendemediumnuovergeleverdaande leentransactiesvanbanken,diegeengelduitlenen,maargeldbeloventegevendat zeniethebben." IrvingFisher,Econoom&Auteur Alsdelenerdeschuldbelofteondertekent,zetdebankdetransactieopdebalans doorhetmakenmeteenpaartoetsaanslagenopdecomputervaneengelijke schuldvandebankaandelener.vanuithetoogpuntvandelenerwordtdit geleendgeldopzijnofhaarrekeninggezet.enomdatdeoverheiddezeschuld vandebankaandelenertoestaatomomgezettewordeninoverheids2iatvaluta, moetiedereenhetaccepterenalsgeld. Nogmaals,debasiswaarheidisergeenvoudig.Zonderhetdocumentdatdelener ondertekende,haddebankiernietsomuittelenen. Hebjejeweleensafgevraagdhoeiedereen,deoverheid,decorporaties,kleine bedrijven,families,allemaaltegelijkertijdschuldkunnenhebbenenvoorzulke astronomischebedragen?hebjejeweleensafgevraagdhoeerzoveelgeldkan zijnomuittelenen? Nuweetjehet,datiserniet. Bankenlenengeengelduit.Zemakenheteenvoudigwegvanschuld. Enomdatschuldpotentieelonbeperktis,isdeaanvoervangelddatook.Enzo blijkt,isdetegenovergesteldesituatieookwaar:geenschuld,geengeld. Ishetnietverbazingwekkenddatondanksdeenormeovervloedaan hulpbronnen,innovatieenproductiviteitdieonsomringen,bijnaiedereen,van overhedentotbedrijventotindividuenallemaalzwareschuldenhebbenbij bankiers?alsmenseneenszoudenstoppenenzichafvragenhoedatkan!hoekan hetzijndatdemensendiedeechterijkdomindewereldproduceren (landbouwersbijvoorbeeld)schuldhebbenbijhendieslechtshetgelduitlenen datdierijkdomvertegenwoordigt. Nogverbazingwekkenderishetdatalsgeldschuldisenergeenschuldwas,er dusookgeengeldzouzijn. "Datiswatonsgeldsysteemis.Alsergeenschuldenzoudenzijninonsgeldsysteem, danzouergeengeldmeerzijn." MarinnerS.Eccles,Voorzitter&GouverneurvandeFederaleReserve Alsditnieuwisvoorje,danbenjenietdeenige.Demeestemensendenkendat alsalleschuldenzoudenzijna/betaald,detoestandvandeeconomiezou verbeteren.datiszekerwaaropindividueelniveau.zoalswijmeertebesteden hebbenalsonzeleningisafgelost,denkenwijdatalsniemandmeerschuldzou hebben,eroverhetgeheelmeergeldzouzijnomtespenderen.maardewaarheid ishettegenovergestelde.erzouhelemaalgeengeldzijn. Daarhebjehet.Wezijnvollediga4hankelijkvanvoortdurendvernieuwd bankkrediet,anderszouerhelemaalgeengeldzijn.geenleningen,geengeld. DatiswatergebeurdetijdensdeGroteDepressie.Degeldaanvoerslonkdrastisch omdatdeaanvoervanleningenopdroogde. 8

9 "Ditiseenverbijsterendegedachte.Wezijnvollediga7hankelijkvancommerciële banken.menmoetiederedollarlenendieinomloopis,contantofkrediet.alsde bankenruimschootssynthetischgeldmaken,zijnwewelvarend;zoniet,dan verhongerenwe.wezittenabsoluutzonderpermanentgeldsysteem.wanneerjehet heleplaatjeziet,isdetragischeabsurditeitvanonzehopelozepositiehaast onvoorstelbaar,maarzoishet." RobertH.Hemphill,KredietmanagerFederaleReservebank,Atlante, Georgia.Perpetualdebt Datisnognietalles.Bankencreërenalleendehoofdsom.Zecreërenniethetgeld omderentetebetalen.waarmoetdatvandaankomen? Deenigeplekwaarlenersgeldkunnenverkrijgenomhunrentetebetalenisde geldhoeveelheidvandetotaleeconomie.maarbijnadiehelegeldhoeveelheidis opdezelfdemaniergemaakt.hetisbankkredietdatmoetwordenterugbetaald metmeerdanwerdgecreëerd.dusoveralzijnerlenersindezelfdesituatiedie driftigproberenhetgeldteverkrijgendatzenodighebbenomzowelde hoofdsomalsderenteterugtebetalenuiteentotalegeldhoeveelheiddiealleen dehoofdsombevat.hetisduidelijkonmogelijkvooriedereenomdehoofdsom plusderenteterugtebetalen,wanthetrentegeldbestaatniet.ditkanzelfs wordenuitgedruktineensimpelewiskundigeformule: P/(P+I)zalhunleencontractnakomen. I/(P+I)zullenfaillietgaan. Hetgroteprobleemhierisdatvoorlanglopendeleningenalshypothekenen staatsschulddehoeveelheidrentedehoofdsomveroverschrijdt.tenzijerveel extrageldwordtgecreëerdomderentetebetalen,betekentditeenhoogaantal faillissementeneneenniet functionerendeeconomie.omeenfunctionele maatschappijtehebbenmoethetaantalfaillissementenlaagzijn.omditte bereikenmoetersteedsmeerschuldgeldwordengecreëerdomaandehuidige vraagnaargeldtevoldoenomdevoorgaandeschuldaftebetalen.maarditmaakt detotaleschuldnatuurlijkgroterendatbetekentdatermeerrentemoetworden betaald,watresulteertineenimmerescalerende,onafwendbarespiraalvanzich opstapelendeschuld. Hetisslechtshettijdsverschiltussendegeldcreatiealsnieuweleningenenhet terugbetalendatvoorkomtdathetgeldtekorttoeslaatenhethelesysteemfailliet maakt.maarterwijlhetonverzadigbarekredietmonstervandebankengroteren groterwordt,wordtdenoodzaakommeerschuldgeldtecreërenomhette voedenalmaardringender. Waaromzijnderentetarievenzolaag? Waaromkrijgenweongevraagdecreditcardsmetdepost? WaaromspendeertdeAmerikaanseoverheidsnellerdanooit? Isdithetafwendenvaneeninstortingvanhethelemonetairesysteem? Eenrationeelpersoonmoetzichafvragenofditechteeuwigdoorkangaan. Iseeninstortingnietonafwendbaar? 9

10 "Eéndingdatjejemoetrealiserenoveronsfractionelereservebanksysteemisdat, netalsbijeenspelletjestoelendans,zolangdemuziekblijftspelenergeenverliezers zijn." AndrewGause,MonetaireHistoricus Geldfaciliteertproductieenhandel.Alsdegeldhoeveelheidtoeneemt,wordtgeld steedswaardelozer,tenzijdeproductieenhandelindeechtewereldmet dezelfdehoeveelheidgroeien.teldaarderealisatiebijopdatalswehorendatde economiegroeitmet3%perjaarheteenconstantestijginglijkt,maardatnietis. De3%vanditjaarvertegenwoordigtmeergoederenendienstendande3%van vorigjaar wanthetis3%vanhetnieuwetotaal.inplaatsvanderechtelijndieje jevoorsteltbijdiewoorden,isheteigenlijkeenexponentiëlecurvediealmaar steilerwordt. "Degrootstetekortkomingvandemensheidisonsonvermogenomdeexponentiële functietebegrijpen." AlbertA.Bartlett,physicist Hetprobleemisnatuurlijkdateeuwigegroeivandeechteeconomieeeuwig escalerendgebruikvangrondstoffenenenergievereist.steedsmeergoederen moetenvangrondstoftotafvalworden,iederjaar,vooraltijd,enkelomte voorkomendatditsysteeminstort. "Iemanddiedenktdatexponentiëlegroeieeuwigdoorkangaanineeneindige wereldiseengestoordeofeeneconoom." KennethBoulding,economist Viereenvoudigevragen Watkunnenwijdoenaandezeronduitgriezeligesituatie? Iniedergevalhebbenweeenheelanderideevangeldnodig.Hetistijddatmeer mensenzichzelfenhunoverhedenviersimpelevragenstellen. Overalterwereldlenenoverhedengeldmetrentevanprivatebanken. Staatsschuldiseengrootdeelvandetotaleschuld.Hetonderhoudenvandie schuldvraagtveelbelastinggeld.wewetendatbankenhetgeldcreërendatze uitlenen.overhedenhebbenzetoestemminggegevendittedoen.dus,deeerste vraagis: 1)Waaromlenenoverhedengeldvanbankenmetrentealsdeoverheidalhet rentevrijegeldzelfkanmaken? Detweedegrotevraagis: 2)Waaromüberhauptgeldalsschuldcreëren?Waaromgeengeldcreërendat continuecirculeertennieteeuwigmetrenteherleendmoetwordenomte bestaan? Derdevraag: 3)Hoekaneengeldsysteemdatalleenkanfunctionerenmeteeuwigversnellende groeigebruiktwordenomeenduurzameeconomieoptebouwen?ishetniet 10

11 vanzelfsprekenddateeuwigversnellendegroeienduurzaamheidonverenigbaar zijn? Enuiteindelijk: 4)Watisermetonshuidigesysteemdathettotaala4hankelijkmaaktvan eeuwigegroei?watmoeterveranderdwordenomeenduurzameeconomie mogelijktemaken? Woeker Ooitwerdhetrekenenvanrenteopleningen'woekeren'genoemd.Erstonden zwarestraffenop,zelfsdedoodstraf.iederegrotegodsdienstverboodwoekeren. Demeesteargumententegendepraktijkwarenmoreel.Mengeloofdedathet eniglegitiemedoelvangeldwasomdeuitwisselingvanechtegoederenen dienstentevergemakkelijken.iederevormvangeldverdienendoorsimpelweg geldtebezittenwerdgezienalsdedaadvaneenparasietofvaneendief.echter, toendekredietbehoeftevandecommercietoenam,verlorendemorele argumentenhetuiteindelijktegenhetargumentdatuitlenenrisicometzich meebrengtenverliesvanmogelijkhedenvandeuitlener.daaromiswinstmaken dooruitlenengerechtvaardigd. Tegenwoordiglijkendezeideeënouderwets.Nuwordthetideeomgeldte verdienenmetgeldgezienalseenideaalomnaartestreven.waaromzouje werken,alsjouwgeldkanwerkenvoorjou?echter,alsjejeeenduurzame toekomstvoorstelt,ishetduidelijkdathetrekenenvanrentezoweleenmoreel alseenpraktischprobleemis. Steljeeenmaatschappijeneconomievoordiedeeeuwenkandoorstaanomdat ze,inplaatsvanhaarenergiereservesteplunderen,zichzelfbeperkttotwater vandaagbinnenkomt.erwordtnietmeerhoutgekaptdanerbijgroeitindezelfde periode.alleenergieishernieuwbaar:zon,zwaartekracht,geothermische en magnetischeenergieenwatwenogmeerontdekken.dezemaatschappijleeft binnendegrenzenvanhaarniet hernieuwbarebronnendooralleste hergebruikenenrecyclen.endepopulatievervangtzichzelfgewoon. Zo nmaatschappijzounooitkunnenfunctionerenmeteengeldsysteemdattotaal a"hankelijkisvaneeuwigversnellendegroei.eenstabieleeconomieheefteen geldsysteemnodigdattenminsteinstaatisstabielteblijvenzonderintestorten. Latenweonsvoorstellendathettotalevolumevandestabielegeldhoeveelheid wordtvastgelegd.latenweonsookvoorstellendatgelduitlenersookbestaand geldmoetenhebbenomuittelenen.alssommigemensenindeze geldhoeveelheidsystematischgeldmetrentegaanuitlenen,neemthundeelinde geldhoeveelheidtoe.alszealhetgelddatwordtterugbetaaldblijvenuitlenen tegenrente,watisdanhetonvermijdelijkeresultaat?ofhetnugoud,8iat of schuldgeldis,maaktnietuit.degelduitlenerskrijgenuiteindelijkalhetgeld.en alsallefaillissementenenbankroetszijnafgehandeld,krijgenzealleechte 11

12 goederenook.alleenalsdeinkomstenvanlenenmetrenteeerlijkverdeeld wordenonderdebevolkingzouditkernprobleemwordenopgelost.hoge belastingenopbankwinstenzoudenditkunnenbereiken.maarwaaromzouden bankendannogzakenwillendoen? Alsweonsooitzoudenbevrijdenvandehuidigesituatiekunnenweons bankierenvoorstellenalseennon pro$ inkomstenuitrentewordenverdeeldalseenuniverseelburgerdivident,of uitlenenhelemaalzonderrenteterekenen. Ikhebnogniemandgehaddiemetlogicaenverstandkonverantwoordendatde federaleoverheidhetgebruikvanhaareigengeldmoetlenen...ikgeloofdatereen tijdkomstdatmenseneisendatditverandert.ikgeloofdatereentijdkomtindit landwaarinzejouenmijeniedereeninhetcongresdeschuldzullengevenvanhet nutteloostoekijkenterwijlzo nidiootsysteemblijftbestaan. WrightPatman,DemocratischCongreslid Hetsysteemveranderen Alsdefundamenteleaardvanhetsysteemdeproblemenveroorzaakt,zal bijsturenvandatsysteemdieproblemennooitoplossen.hetsysteemzelfmoet vervangenworden. Veelmonetairecriticipleitenvooreenterugkeernaaropgoudgebaseerdgeld.Ze bewerendatgoudeenlangehistorievanbetrouwbaarheidheeft.zenegerende velevormenvanoplichtingdiemetgoudmogelijkzijn:hetafvijlenvanmunten, hetaanlengenvanmetaal,allesopkopenendeprijsopdrijven.ditvondallemaal ruimschootsplaatsinhetouderomeendroegbijaanhaarondergang.sommigen radenzilveraanomdatermeervanisdangoud,waardoorhetmoeilijkerisde prijstebeïnvloeden. Velenbetwijfelenofedelmetalenüberhauptwelterugmoetenkeren.Niemand wilmeereenzwarezakmuntenmeenemenomtewinkelen.hetiszekerdat papier,digitaal,plastic ofnogwaarschijnlijker,biometrischid geldhet mediumvanhandelzalwordenmetdezelfdemogelijkheidtothetcreërenvan onbeperktschuldgeldzoalsnu.daarnaast,alsgoudweerdeenigewettigebasis voorgeldzouworden,zoudenzijdiegeengoudhebbenplotselinggeengeldmeer hebben.anderepleitbezorgersvoormonetairehervorminghebbenvastgesteld dathebzuchtenoneerlijkheiddebelangrijksteproblemenzijnendater misschienbeteremanierenzijnvooreeneerlijkenopengeldsysteemdan terugkerennaarzilverofgoud. Inventievegeestenhebbeneenaantalalternatievemanierenvoorgesteldomgeld tecreëren.veelprivateruilhandelsystemencreërengeldalsschuld,zoalsbanken doen,maarhetwordtopenlijkgedaanenzonderrenteterekenen.eenvoorbeeld iseenruilhandelsysteemwaarinschuldwordtuitgedruktalsbeloftenvooruren arbeid.alleurenwordengelijkwaardiggewaardeerdopeendollarschaal,zodat 12

13 urenkunnenwordenomgerekendnaardedollarprijsvangoederen.zo n geldsysteemkandooriedereenwordenopgezetdieeenmanierverzintomde boekhoudingtedoenengenoegenbetrouwbaredeelnemersvindt.eenlokaal ruilhandelsysteemopzetten,ookalzouhetnuweinignuthebben,zoueenslim noodplanzijnvooriederegemeenschap. Monetairehervormingisnetalspolitiekehervorming,eengrootonderwerpdat eenwiltotveranderingvereisteneenwilombuitenkaderstedenken.monetaire hervormingzalnetalspolitiekehervorming,nietgemakkelijktotstandkomen. Wantdekrachtigebelanghebbendendiepro+iterenvanhethuidigesysteem zullenallesdoenomhunvoordeeltebehouden. Nuwegezienhebbendatgeldslechtseenideeisendatgeldinwerkelijkheidalles kanzijnwatwijhetmaken,ishiereensimpelalternatiefmonetairconceptomte overwegen.ditmodelisgebaseerdopsystemendieinhetverledenhebben gewerktinengelandenamerika.systemendieondermijndenvernietigdzijn doordegoudsmid bankiersenhunfractionelereservesysteem. Omeeneconomietecreërenoppermanentrentevrijgeld,zougeldsimpelweg doordeoverheidkunnenwordengecreëerdengespendeerdindeeconomie het liefstaanduurzameinfrastructuurdiedeeconomieondersteunt,zoalswegen, spoorwegen,bruggen,havensenpubliekemarkten.ditgeldzounietworden gecreëerdalsschuld.hetzouwordengecreëerdalswaarde.dewaardeisdan waarhetaanuitgegevenwerd.alsditnieuwegeldeenproportionelegroeiin handelmogelijkmaaktezouhethelemaalgeenin1latieveroorzaken. Alsoverheidsuitgavenwelin2latiezoudenveroorzaken,zoudenertweemogelijke optieszijn. In#latieisinwezeneenproportionelebelastingopgeld.Ofhetgeldnu20% inwaardedaaltofdeoverheid20%vanonsgeldafpakt,heteffectoponze koopkrachtishetzelfde.(nuhebbenwebeide:in9latieénbelastingen!!)op dezemanierzouin,latieinplaatsvanbelastingpolitiekacceptabelzijn, indienhetgoedbesteedwordtenbeperktblijft. Ofdeoverheidkanin.latietegengaandoorbelastinggeldteinnendatzedan uitroulatieneemt.hierdoorkrimptdegeldhoeveelheidenwordtdewaarde hersteld. Omde&latietegentegaan,hetverschijnselvandalendelonenenprijzen,kande overheidsimpelwegmeergeldbesteden,duscreëren.zonderconcurrerende, privateschuldgeldcreatiezoudenoverhedeneffectieverecontrolehebbenoverde geldhoeveelheidvanhunland.debevolkingweetwiedeschuldigeisalshetfout gaat.regeringenzoudenkomenengaan,a2hangendvanhunvermogenomde geldwaardetehandhaven.deoverheidzouvoornamelijkdraaienop belastinggeld,netalsnu.maarmetditbelastinggeldkoopjeveelmeer,omdater geenrentehoefttewordenbetaaldaanprivatebankiers.erkangeen staatsschuldzijnalsdefederaleoverheidsimpelweghetgeldmaaktdatzenodig 13

14 heeft.onzeeeuwige,gezamenlijkelijfeigenschapaandebankendoor rentebetalingenoverstaatsschuldzouonmogelijkzijn. Geldiseennieuwevormvanslavernij,teonderscheidenvandeoudedoorhet simpelefeitdathetonpersoonlijkis,erisgeenmenselijkerelatietussendemeester endeslaaf. LeoTolstoy Deonzichtbarekracht Niemandismeergeknechtdanhijdietenonrechtedenktvrijtezijn. Goethe Watonsgeleerdisalsdemocratieenvrijheid,isinwerkelijkheideeningenieuze enonzichtbarevormgewordenvaneconomischedictatuur.zolangonzehele maatschappijvollediga1hankelijkblijftvoorhaargeldhoeveelheidvan bankkrediet,zijnbankiersindepositieomtebeslissenwiehetgeldkrijgtdatzij nodighebbenenwieniet. Hetmodernebanksysteemmaaktgelduithetniets.Ditprocesismisschiende meestverbazingwekkendetrucdieooituitgevondenis.bankierenwasbedachtin onrechtengeboreninzonde.bankiersbezittendeaarde.neemjezeditaf,maar laatjehendemachtomgeldtecreëren,danzullenzemeteenpennenstreekgenoeg geldcreërenomhetterugtekopen...neemdezegrotemachtvanzewegenalle grotefortuinen,zoalshetmijne,zullenverdwijnenenzoudenmoetenverdwijnen, wantdanzouditeenbetereenblijerewereldzijn.maaralsjeslaafwiltblijvenvan debankenendekostenvanjeeigenslavernijwiltbetalen,laatbankiersdangeld blijvencreërenenkredietbeheren. SirJosiahStamp,DirecteurBankvanEngeland Hetonvermogenvandekolonistenomdemachtoverhuneigengelduitdehanden vangeorgeiiiendeinternationalebankierstekrijgenwasdehoofdredenvoorde Ona$hankelijkheidsoorlog. BenjaminFranklin TegenwoordigwetenweinigmensendatdegeschiedenisvandeVS,sindsde Revolutiein1776grotendeelshetverhaalisvaneenepischestrijdomvrijte wordenenteblijvenvandemachtvaneuropeseeninternationalebanken.deze strijdwerduiteindelijkverlorenin1913,toenpresidentwoodrowwilsonde FederalReserveWetondertekende,waarmeehetinternationalebankkartelde machtkreegoverhetcreërenvanamerika sgeld. Ikbeneenzeerongelukkigman.Ikhebonwetendmijnlandgeruïneerd.Eengroots industrieellandwordtbestuurddoorhaarkredietsysteem.onskredietsysteemis geconcentreerd.degroeivanditlandenalonzeactiviteitenzijninhandenvaneen paarmensen.wezijnéénvandeslechtstbestuurdeenmeestgedomineerde 14

15 regeringenindebeschaafdewereld,nietlangereenregeringvanvrijeopinie,niet langereenregeringvanovertuigingendestemvandemeerderheid,maareen regeringvandemeningeninvloedvaneenkleinselectgezelschap. WoodrowWilson,PresidentvandeVS Dekrachtvanditsysteemzitdiepingebakken,netalsdeeducatie enmediastilte rondhetonderwerp.jarengeledeninterviewdedecanadesevice premiergrote aantallenniet economen,zowelhoogopgeleideprofessionalsalsnuchtere mensen,opstraatenontdektedatniemandeenjuistbegriphadvanhoegeld wordtgemaakt.jekuntwaarschijnlijkwelzeggendatdemeestemensen, waaronderdebaliemedewerkersvanbanken,nognooitoverhetonderwerp hebbennagedacht.jijwel? Alleverbazing,verwarringenpaniekinAmerikastamtnietuittekortkomingenin degrondwetofconfederatie,nietuitdezuchtnaareerofdeugd,maaruitde completeonwetendheidoverdeaardvanmunt,kredietencirculatie. JohnAdams, FoundingFather vandeamerikaansegrondwet Hetmoderne geld als schuld systeemwerdietsmeerdan300jaargeleden geborentoendeeerstebankvanengelandwerdopgezetmeteenkoninklijke toestemmingvoorhetfractioneeluitlenenvangoudreçu smeteenbescheiden verhoudingvan2:1.diebescheidenverhoudingwaseenspreekwoordelijkevoet tussendedeur.hetsysteemisnuwereldwijd,creëertvrijwelonbeperkte hoeveelhedengelduithetnietsenheeftbijnaiedereenopdeplaneet vastgeketendaaneenimmergroeiendeschulddienooitkanwordena4betaald. Kandatallemaalperongelukzijngebeurd?Ofisheteensamenzwering?Hier staatduidelijkietsheelgrootsophetspel. Diegenediedehoeveelheidgeldbeheerstinonslandisabsoluutmeestervanalle industrieenhandel...enwanneerjejebeseftdathethelesysteemergmakkelijkte besturenvaltopverschillendemanierendooreenpaarmachtigemannenaande top,hoeftniemandjetevertellenhoein2latieendepressiesontstaan. JamesA.Gar+ield,vermoordePresidentvandeVS Deoverheidmoetalhetgeldenkredietdatnodigisomhetuitgavenpatroonvan deoverheidendekoopkrachtvandeburgerstebevredigencreëren,uitgevenenin circulatiebrengen.doordezeprincipesaantenemenwordtdebelastingbetalereen immensesomaanrentebespaard.hetprivilegevanhetcreërenenuitgevenvan geldisnietalleenhetultiemevoorrechtvaneenregering,hetisookhaargrootste creatievemogelijkheid. AbrahamLincoln,vermoordePresidentvandeVS Totdatdemachtovergeld enkredietcreatieisteruggenomendoordeoverheiden wordterkendalshaaropvallendsteenheiligsteverantwoordelijkheid,isdiscussie overeensoevereinparlementendemocratiewaardeloosenzinloos.wanneereen 15

16 landbreektmethaarmachtoverkrediet,maakthetnietuitwiedewettenmaakt... Woekerzal,wanneerhetaandemachtkomt,iederlandverwoesten. WilliamLyonMcKenzieKing,voormaligpremiervanCanada WijzijndeWashingtonPost,deNewYorkTimes,TimeMagazineenandere toonaangevendemedia,wierhoofdredacteurenonzemeetingshebbenbijgewoond, zeererkentelijkdatzijhunbeloftevangeheimhoudingbijna40jaarlangtrouwzijn nagekomen.hetzouvooronsonmogelijkzijngeweestonzeplannente verwezenlijkenalswealdiejarenaandepubliciteitzoudenzijnblootgesteld.maar, supranationalesoevereiniteitvaneenintellectueleeliteenwereldbankiersisverre teprefererenbovenhetnationalezel0beschikkingsrechtvandeafgelopeneeuwen. DavidRockefellerineentoespraakvoordeTrilateraleCommissie,1991 Alleenkleinegeheimenhoevenbeschermdteworden.Grotegeheimenworden beschermddoorpubliekongeloof. MarshallMcLuhan,Media goeroe 16

Aim of this presentation. Give inside information about our commercial comparison website and our role in the Dutch and Spanish energy market

Aim of this presentation. Give inside information about our commercial comparison website and our role in the Dutch and Spanish energy market Aim of this presentation Give inside information about our commercial comparison website and our role in the Dutch and Spanish energy market ( Founded in 2004

Nadere informatie


TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN. JAARGANG 1999 Nr. 27 57 (1998) Nr. 1 TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN JAARGANG 1999 Nr. 27 A. TITEL Protocol tot wijziging van de Overeenkomst tussen het Koninkrijk der Nederlanden en de Republiek Zuid-Afrika

Nadere informatie

Socio-economic situation of long-term flexworkers

Socio-economic situation of long-term flexworkers Socio-economic situation of long-term flexworkers CBS Microdatagebruikersmiddag The Hague, 16 May 2013 Siemen van der Werff - - +31 20 525 1630 Discussion topics and conclusions

Nadere informatie

Luchtkwaliteit: een Europees perspectief

Luchtkwaliteit: een Europees perspectief Luchtkwaliteit: een Europees perspectief Conferentie Luchtkwaliteit Brussel, 5 december 2014 Dr Hans Bruyninckx Executive Director European Environment Agency EEA rapporten 2014 Luchtverontreiniging een

Nadere informatie

URENSTAAT WBSO. Totaal aantal S&O uren Dag. De urenstaat dient dagelijks per persoon, per project te worden bijgehouden. Maand: januari 2015

URENSTAAT WBSO. Totaal aantal S&O uren Dag. De urenstaat dient dagelijks per persoon, per project te worden bijgehouden. Maand: januari 2015 Maand: januari 215 Maand: februari 215 Maand: maart 215 Maand: april 215 een controle of de Belastingdienst ter inzage liggen. Maand: mei 215 Maand: juni 215 Maand: juli 215 Maand: augustus

Nadere informatie

The role of local municipalities and labor market regions in adult education: monitoring quality

The role of local municipalities and labor market regions in adult education: monitoring quality Deze dia-indeling is zo gemaakt dat zelf een afbeelding kan worden geplaatst. Klik met de rechtermuisknop in de achtergrond en kies Achtergrond opmaken. Klik op Opvulling met figuur of bitmappatroon en

Nadere informatie



Nadere informatie

HOTEL COPY - Hudson. 356 West 58th Street, New York, 10019, New York, Manhattan - Midtown, United States

HOTEL COPY - Hudson. 356 West 58th Street, New York, 10019, New York, Manhattan - Midtown, United States HOTEL COPY - PLEASE PRESENT THIS VOUCHER TO THE HOTEL UPON ARRIVAL CONFIRMATION NUMBER: 6660055 Mr SVEN RUYMBEEK Ms TESS JANSSENS Date: 13 JAN 2010 Booking done by : Postal Code:9120 Room Details Check-in

Nadere informatie

Mondeling tentamen Havo - ERK niveau B1 / B1 +

Mondeling tentamen Havo - ERK niveau B1 / B1 + Mondeling tentamen Havo - ERK niveau B / B + Het mondeling voor Engels Havo duurt 5 minuten en bestaat uit een gesprek met je docent waarin de volgende onderdelen aan de orde komen: *Je moet een stukje

Nadere informatie

URENSTAAT WBSO. Totaal aantal S&O uren Dag. De urenstaat dient dagelijks per persoon, per project te worden bijgehouden. Maand: januari 2016

URENSTAAT WBSO. Totaal aantal S&O uren Dag. De urenstaat dient dagelijks per persoon, per project te worden bijgehouden. Maand: januari 2016 Maand: januari 216 Projektnummer S&O 1 2 3 4 5 6 7 8 9 1 11 12 13 14 15 16 17 18 19 2 21 22 23 24 25 26 27 28 29 3 31 Totalen per maand Maand: februari 216 Projektnummer S&O 1 2 3 4 5 6 7 8 9 1 11 12 13

Nadere informatie

The Dutch mortgage market at a cross road? The problematic relationship between supply of and demand for residential mortgages

The Dutch mortgage market at a cross road? The problematic relationship between supply of and demand for residential mortgages The Dutch mortgage market at a cross road? The problematic relationship between supply of and demand for residential mortgages 22/03/2013 Housing market in crisis House prices down Number of transactions

Nadere informatie

The soy chain. From field to supermarket: Local impacts of mass production. What do you think when you hear soy? Do you think of

The soy chain. From field to supermarket: Local impacts of mass production. What do you think when you hear soy? Do you think of The soy chain From field to supermarket: Local impacts of mass production Do you think of The Dutch Soy Coalition: Foto Brent Millikan Foto AIDEnvironment Foto Ulrike Bickel Foto CPT 1 Herkomst foto: website

Nadere informatie

Kennismanagement en innovatie. Gorinchem, 13 december 2011

Kennismanagement en innovatie. Gorinchem, 13 december 2011 Kennismanagement en innovatie Hans Berends (TU Eindhoven) Gorinchem, 13 december 2011 Innovation, Technology Entrepreneurship & Marketing Group School of Industrial Engineering (TU/e) Research: one of

Nadere informatie

Online request form for requesting articles, books and / or theses: Erasmus MC - employees

Online request form for requesting articles, books and / or theses: Erasmus MC - employees Online request frm fr requesting articles, bks and / r theses: Erasmus MC - emplyees New accunt : Register Medical Library website: On the right handed side, chse Quicklink 6. Online requestfrm articles

Nadere informatie

Wat is bepalend voor succes van duurzame mobiliteit?

Wat is bepalend voor succes van duurzame mobiliteit? Inzicht in actuele operationele kosten van duurzame mobiliteit' Wat is bepalend voor succes van duurzame mobiliteit? Duurzame mobiliteit Succes Kosten TOEKOMST? Jan van de Velde Aanschaf in B2B TCO Inzicht

Nadere informatie

De Cambridge English presentatie voor de leerlingen. Jane West & Fokke de Jong (docenten Engels)

De Cambridge English presentatie voor de leerlingen. Jane West & Fokke de Jong (docenten Engels) De Cambridge English presentatie voor de leerlingen Jane West & Fokke de Jong (docenten Engels) CAMBRIDGE CERTIFICATE Da Vinci 2015-2016 WHO IS IT FOR? -- IT IS FOR YOU! - Do this programme if you are

Nadere informatie

Kwalitatieve Studie naar Motivatie en Barrières van Etnische Minderheden uit Amsterdam

Kwalitatieve Studie naar Motivatie en Barrières van Etnische Minderheden uit Amsterdam Kwalitatieve Studie naar Motivatie en Barrières van Etnische Minderheden uit Amsterdam Zuidoost om zich bij de Soa-polikliniek van de GGD Amsterdam te laten Testen op Soa s en Hiv A Qualitative Research

Nadere informatie

Sport participation and the role of sport facilities in the Netherlands

Sport participation and the role of sport facilities in the Netherlands een afbeelding (smal) te plaatsen. Daarna via opmaak de afbeelding naar de Sport participation and the role of sport facilities in the Netherlands Play the Game conference Aarhus, Denmark 28-31 October

Nadere informatie

ZATERDAG 21 MEI 2016 INTERNATIONAAL D1 EN C1 TOP JEUGDTOERNOOI. Voorwoord jeugdvoorzitter TOGB: Internationaal D1 en C1 top jeugdtoernooi

ZATERDAG 21 MEI 2016 INTERNATIONAAL D1 EN C1 TOP JEUGDTOERNOOI. Voorwoord jeugdvoorzitter TOGB: Internationaal D1 en C1 top jeugdtoernooi Voorwoord jeugdvoorzitter TOGB: ZATERDAG 2 MEI 206 De competitie zit er weer (bijna) op. De stijgende lijn van de afgelopen jaren bij de jeugd hebben we weer weten door te zetten. En daar hoort ook bij

Nadere informatie

Trends and dilemma s in an aging society

Trends and dilemma s in an aging society Trends and dilemma s in an aging society Martin van Rijn, CEO PGGM March 11 th 2011 Roadmap PGGM in a nutshell Societies in transformation and the impact on collective schemes The strategy for a pension

Nadere informatie

Ik ben 48 jaar oud, ben gehuwd en moeder van 5 kinderen. Vandaag ben ik Gemeente en OCMWraadslid.

Ik ben 48 jaar oud, ben gehuwd en moeder van 5 kinderen. Vandaag ben ik Gemeente en OCMWraadslid. Ik ben 48 jaar oud, ben gehuwd en moeder van 5 kinderen. Vandaag ben ik Gemeente en OCMWraadslid. Mijn hobby s zijn tennis en bridge. 48 jaar oud, licentiaat in de rechten, master in financiën, studies

Nadere informatie

FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE. Toets Inleiding Kansrekening 1 8 februari 2010

FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE. Toets Inleiding Kansrekening 1 8 februari 2010 FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE Toets Inleiding Kansrekening 1 8 februari 2010 Voeg aan het antwoord van een opgave altijd het bewijs, de berekening of de argumentatie toe. Als je een onderdeel

Nadere informatie

Empowerment project. Driejarig project van Rotaryclub Rhenen-Veenendaal

Empowerment project. Driejarig project van Rotaryclub Rhenen-Veenendaal Empowerment project Awasi Kenya Driejarig project van Rotaryclub Rhenen-Veenendaal Empowerment*van* kinderen*in*kenia De#afgelopen#drie#jaren# hebben#we#met#steun#van#de# Rotaryclub##Rhenen: Veenendaal#een#

Nadere informatie

Oudercommissie/Parents Committee. Notulen/Meeting Minutes #1. 1. Opening

Oudercommissie/Parents Committee. Notulen/Meeting Minutes #1. 1. Opening Oudercommissie/Parents Committee Notulen/Meeting Minutes #1 Datum/Date: Woensdag 21 augustus 2013/ Wednesday August 21st Tijd/Time: 13.00 14.30 Locatie/Location: Jan van Avennesstraat 32, Schiedam Aanwezig/Present:

Nadere informatie


TOELICHTING OP FUSIEVOORSTEL/ TOELICHTING OP FUSIEVOORSTEL/ EXPLANATORY NOTES TO THE LEGAL MERGER PROPOSAL Het bestuur van: The management board of: Playhouse Group N.V., een naamloze Vennootschap, statutair gevestigd te Amsterdam,

Nadere informatie

Night news. Fact sheets. Worksheet

Night news. Fact sheets. Worksheet 1 Night news read Het liedje van Caro Emerald speelt zich s nachts af. Lees twee nieuwsberichten die met nacht te maken hebben. Nieuwsbericht 1 Nieuwsbericht 2 Clouds block view for meteor watchers Do

Nadere informatie

In te vullen door de docent: Cijfer: = Slechts hele punten toekennen! 5,4. In te vullen door de student: Naam: Groep: Collegiale toetsing

In te vullen door de docent: Cijfer: = Slechts hele punten toekennen! 5,4. In te vullen door de student: Naam: Groep: Collegiale toetsing In te vullen door de docent: Cijfer: = Slechts hele punten toekennen! 5,4 In te vullen door de student: Naam: Studentnummer: Docent: Groep: Collegiale toetsing FN2VS2FE01-1 HEEJM Aanwijzingen: N.B. Lees

Nadere informatie

MobiDM App Handleiding voor Windows Mobile Standard en Pro

MobiDM App Handleiding voor Windows Mobile Standard en Pro MobiDM App Handleiding voor Windows Mobile Standard en Pro Deze handleiding beschrijft de installatie en gebruik van de MobiDM App voor Windows Mobile Version: x.x Pagina 1 Index 1. WELKOM IN MOBIDM...

Nadere informatie

Tentamen Marine Sciences (2006)

Tentamen Marine Sciences (2006) Tentamen Marine Sciences (2006) Donderdag 2 februari 2006, 14.00-17.00hrs Went GROEN NB1: schrijf Uw naam en studentnummer op ieder in te leveren blad NB2: er zijn vijf vragen aub deze vragen indivudeel

Nadere informatie

Zorg, ziel en zaken. Johan Polder. Expertmeeting Ziel en zakelijkheid in de zorg, 29 november 2012 Zeist, PGGM

Zorg, ziel en zaken. Johan Polder. Expertmeeting Ziel en zakelijkheid in de zorg, 29 november 2012 Zeist, PGGM Zorg, ziel en zaken Johan Polder Expertmeeting Ziel en zakelijkheid in de zorg, 29 november 2012 Zeist, PGGM 100 90 80 70 60 50 40 30 20 10 Zorguitgaven, 1972-2011 CBS, Zorgrekeningen Miljard euro 0 1970

Nadere informatie

NOC*NSF. Online onderzoek OP2028 hoe kijkt het Nederlands volk hier tegen aan? februari 2009

NOC*NSF. Online onderzoek OP2028 hoe kijkt het Nederlands volk hier tegen aan? februari 2009 NOC*NSF Online onderzoek OP2028 hoe kijkt het Nederlands volk hier tegen aan? februari 2009 Inleiding: kennismakingsaanbod MSI-ACI MSI-ACI heeft het NOC*NSF een gratis kennismakingsaanbod gedaan om een

Nadere informatie

Teksten van de liederen die gospelkoor Inspiration tijdens deze Openluchtdienst zingt.

Teksten van de liederen die gospelkoor Inspiration tijdens deze Openluchtdienst zingt. Don t you worry There s an eternity behind us And many days are yet to come, This world will turn around without us Yes all the work will still be done. Look at ever thing God has made See the birds above

Nadere informatie

Ethiek van voedingsonderzoek in een niet-westerse setting

Ethiek van voedingsonderzoek in een niet-westerse setting Ethiek van voedingsonderzoek in een niet-westerse setting Programma Welkom, Pieter van t Veer, WUR Korte inleiding, Marcel Verweij, UU Drie casus Martin Jäkel, Unilever Ingeborg Bovée, NIZO Inge Brouwer,

Nadere informatie



Nadere informatie

Stationsgebied Utrecht. 19 October 2011

Stationsgebied Utrecht. 19 October 2011 Stationsgebied Utrecht 19 October 2011 1945 175.000 citizens Historic City Centre The past decades Utrecht has grown immensely 2011 > 310.000 citizens 2010 Historic City Centre Utrecht now 4 th city of

Nadere informatie

! " ! " % -,,. % /!.!" 0!1 2!3

!  !  % -,,. % /!.! 0!1 2!3 !" #! $ % &'()**))+&,,! " % -,,. % /!.!" 0!1 2!3! " 0 0$ % #! %!, 4 5 %!, 0!$ % % 6" ) "!2 3 " 0 2 +3 " 2-3 " 7 28 1 9*.3 ": 2+0 3 " 2 3 ": ( ";: 7 /!!2 3, " ! 0! *< * < *!< * < *< )! Leverancier Leverancier

Nadere informatie

RAAD VAN DE EUROPESE UNIE. Brussel, 4 december 2007 (OR. en) 15202/07 VISA 346 COMIX 968

RAAD VAN DE EUROPESE UNIE. Brussel, 4 december 2007 (OR. en) 15202/07 VISA 346 COMIX 968 RAAD VAN DE EUROPESE UNIE Brussel, 4 december 2007 (OR. en) 15202/07 VISA 346 COMIX 968 WETGEVINGSBESLUITEN EN ANDERE INSTRUMENTEN Betreft: BESCHIKKING VAN DE RAAD tot wijziging van deel 1 van het Schengen-raadplegingsnetwerk

Nadere informatie


PHARMING MAAKT RESULTATEN Q1 2006 BEKEND PHARMING MAAKT RESULTATEN Q1 2006 BEKEND Solide kaspositie en uitbreiding van productportfolio Leiden, 26 april 2006. Biotechnologiebedrijf Pharming Group NV ( Pharming of de onderneming ) (Euronext: PHARM)

Nadere informatie

Instructie Deze tussentoets bevat 18 mc-vragen. Dit voorblad moet van de toetsvragen worden afgescheurd en met het mcantwoordenvel

Instructie Deze tussentoets bevat 18 mc-vragen. Dit voorblad moet van de toetsvragen worden afgescheurd en met het mcantwoordenvel Tussentoets Financiering propedeuse 24 april 2009 Versie 1 Naam. Collegekaartnummer/studentnummer.. Handtekening.. Instructie Deze tussentoets bevat 18 mc-vragen. Dit voorblad moet van de toetsvragen worden

Nadere informatie


TRACTATENBLAD VAN HET KONINKR IJ K DERNEDER LAND EN. JAARGANG 1961 Nr. 110 19 (1961) Nr. 1 TRACTATENBLAD VAN HET KONINKR IJ K DERNEDER LAND EN JAARGANG 1961 Nr. 110 A. TITEL Protocol tot wijziging van artikel 50 (SL) van het Verdrag inzake de internationale burgerluchtvaart;

Nadere informatie


TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN. JAARGANG 1996 Nr. 209 25 (1996) Nr. 1 TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN JAARGANG 1996 Nr. 209 A. TITEL Protocol tussen het Koninkrijk der Nederlanden en de Tsjechische Republiek tot wijziging van de Overeenkomst

Nadere informatie


TRACTATENBLAD VAN HET 12 (1974) Nr. 5 TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN JAARGANG 2010 Nr. 202 A. TITEL Overeenkomst tussen het Koninkrijk der Nederlanden en de Tsjechoslowaakse Socialistische Republiek tot het

Nadere informatie

LCA, wat kan je er mee. Sustainability consultant gaasbeek@pre

LCA, wat kan je er mee. Sustainability consultant gaasbeek@pre LCA, wat kan je er mee Anne Gaasbeek Anne Gaasbeek Sustainability consultant gaasbeek@pre PRé Consultants PRé is pionier i van LCA sinds 1990; ontwikkelaar van Ecoindicator and ReCiPe

Nadere informatie

Statistische gegevens van het Nederlandse register voor burgerluchtvaartuigen Statistics of the civil aircraft register of the Netherlands

Statistische gegevens van het Nederlandse register voor burgerluchtvaartuigen Statistics of the civil aircraft register of the Netherlands Statistische gegevens van het Nederlandse register voor burgerluchtvaartuigen Statistics of the civil aircraft register of the Netherlands Op de volgende bladzijden vindt u een aantal grafieken en gegevens

Nadere informatie



Nadere informatie

Over dit boek. Richtlijnen voor gebruik

Over dit boek. Richtlijnen voor gebruik Over dit boek Dit is een digitale kopie van een boek dat al generaties lang op bibliotheekplanken heeft gestaan, maar nu zorgvuldig is gescand door Google. Dat doen we omdat we alle boeken ter wereld online

Nadere informatie

Usage guidelines. About Google Book Search

Usage guidelines. About Google Book Search This is a digital copy of a book that was preserved for generations on library shelves before it was carefully scanned by Google as part of a project to make the world s books discoverable online. It has

Nadere informatie

Multi user Setup. Firebird database op een windows (server)

Multi user Setup. Firebird database op een windows (server) Multi user Setup Firebird database op een windows (server) Inhoudsopgave osfinancials multi user setup...3 Installeeren van de firebird database...3 Testing van de connectie met FlameRobin...5 Instellen

Nadere informatie

Multi-disciplinary workshop on Ageing and Wellbeing

Multi-disciplinary workshop on Ageing and Wellbeing Date 7-12-2011 1 Multi-disciplinary workshop on Ageing and Wellbeing Prof. Dr. Inge Hutter Demographer, anthropologist Coordinator Healthy Ageing Alpha Gamma RUG Dean Faculty Spatial Sciences Date 7-12-2011

Nadere informatie

Sectie Infectieziekten

Sectie Infectieziekten Sectie Infectieziekten 1 December 2015 U kunt helpen de HIV / AIDS epidemie te beëindigen You can help to end the HIV / AIDS epidemic Sectie Infectieziekten Weet uw HIV status Know your HIV status by 2020

Nadere informatie

Jaarresultaten 2008 DPA Groep DPA Flex Group N.V. buigt in 2 e halfjaar operationeel verlies om in winst ondanks omzetdaling

Jaarresultaten 2008 DPA Groep DPA Flex Group N.V. buigt in 2 e halfjaar operationeel verlies om in winst ondanks omzetdaling - Resultaten 2008 - Amsterdam, 6 maart 2009 Jaarresultaten 2008 DPA Groep DPA Flex Group N.V. buigt in 2 e halfjaar operationeel verlies om in winst ondanks omzetdaling DPA Flex Group N.V. heeft in 2008

Nadere informatie

Prof. Dr. Carrie J. Menkel-Meadow

Prof. Dr. Carrie J. Menkel-Meadow Invitation to the Public Lecture of Uitnodiging voor de openbare lezing van Prof. Dr. Carrie J. Menkel-Meadow Chancellor's Professor of Law and Political Science, University of California, Irvine School

Nadere informatie

1. Wat is het probleem dat aanleiding is (geweest) voor het beleid? Is dit probleem nog actueel? Wat is de oorzaak van het probleem?

1. Wat is het probleem dat aanleiding is (geweest) voor het beleid? Is dit probleem nog actueel? Wat is de oorzaak van het probleem? Toetsingskader verlenging garantstellingsregeling Zeevisserij Algemene inleiding Deze regeling is voor kotter- of garnalenvissers die willen investeren in verduurzaming van kan de garantstelling hun bedrijf,

Nadere informatie

Lichamelijke factoren als voorspeller voor psychisch. en lichamelijk herstel bij anorexia nervosa. Physical factors as predictors of psychological and

Lichamelijke factoren als voorspeller voor psychisch. en lichamelijk herstel bij anorexia nervosa. Physical factors as predictors of psychological and Lichamelijke factoren als voorspeller voor psychisch en lichamelijk herstel bij anorexia nervosa Physical factors as predictors of psychological and physical recovery of anorexia nervosa Liesbeth Libbers

Nadere informatie

Tim Akkerman - Head of Mobile

Tim Akkerman - Head of Mobile Tim Akkerman - Head of Mobile Emesa is the largest e-commerce company for searching, comparing and booking travel and leisure packages in the following categories: Holidays - Other accommodations - Hotels

Nadere informatie

Onderwerp: klacht inzake reclame van het bedrijfstakpensioenfonds PME (Pensioenfonds voor de MetalEktro)

Onderwerp: klacht inzake reclame van het bedrijfstakpensioenfonds PME (Pensioenfonds voor de MetalEktro) Reclame Code Commissie Postbus 75684 1070 AR Amsterdam Utrecht, 23 oktober 2012 Onderwerp: klacht inzake reclame van het bedrijfstakpensioenfonds PME (Pensioenfonds voor de MetalEktro) Geachte mevrouw,

Nadere informatie

Script. Good health starts with good food. That s true for people as much as it is for animals.

Script. Good health starts with good food. That s true for people as much as it is for animals. Script Good health starts with good food. That s true for people as much as it is for animals. Livestock and fish health influence human health, since animal protein is an indispensable part of our food

Nadere informatie

ZATERDAG 23 MEI 2015 INTERNATIONAAL D1 EN C1 TOP JEUGDTOERNOOI. Voorwoord jeugdvoorzitter TOGB: Internationaal D1 en C1 top jeugdtoernooi

ZATERDAG 23 MEI 2015 INTERNATIONAAL D1 EN C1 TOP JEUGDTOERNOOI. Voorwoord jeugdvoorzitter TOGB: Internationaal D1 en C1 top jeugdtoernooi Voorwoord jeugdvoorzitter TOGB: ZATERDAG 23 MEI 205 De competitie zit er weer (bijna) op. Ik hoop dat we tegen deze tijd kunnen constateren dat we de stijgende lijn van de afgelopen jaren bij de jeugd

Nadere informatie

Waarom stijgen de uitgaven? Prijs- en volume. Vergrijzing als kostenbom. Kostenontwikkeling 1999-2003 Bron: Zorg voor euro s-2

Waarom stijgen de uitgaven? Prijs- en volume. Vergrijzing als kostenbom. Kostenontwikkeling 1999-2003 Bron: Zorg voor euro s-2 Zorguitgaven, 1972-2009 miljard euro (bron:cbs) Macro-economie, gezondheid en zorg Johan Polder 1 NVAG Jubileumcongres 19 november 2010 Zorguitgaven, 1972-2009 miljard euro Zorguitgaven, 1972-2009 miljard

Nadere informatie

STRAATVERLICHTING IN ASSEN. Levenscyclusanalyse van de Kegel 2000 en de Stela Square 10 LED Kerstholt, René

STRAATVERLICHTING IN ASSEN. Levenscyclusanalyse van de Kegel 2000 en de Stela Square 10 LED Kerstholt, René STRAATVERLICHTING IN ASSEN. Levenscyclusanalyse van de Kegel 2000 en de Stela Square 10 LED Kerstholt, René IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's PDF) if you wish

Nadere informatie


FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE Tentamen Analyse 8 december 203, duur 3 uur. Voeg aan het antwoord van een opgave altijd het bewijs, de berekening of de argumentatie toe. Als jeeen onderdeel

Nadere informatie

NBB Scheidsrechtersstage 3 september Onsportieve fout Flop Interpretaties. Nieuwe regels en signalen. Flop/fake

NBB Scheidsrechtersstage 3 september Onsportieve fout Flop Interpretaties. Nieuwe regels en signalen. Flop/fake NBB Scheidsrechtersstage 3 september 2016 Onsportieve fout Flop Interpretaties 1 Nieuwe regels en signalen Flop/fake 1 GAME CLOCK / 2:00 or less Onsportieve fout 2 Onsportieve fouten Deze presentatie heeft

Nadere informatie

Implementatie van herstelondersteunende zorg in de GGz

Implementatie van herstelondersteunende zorg in de GGz De master class, meet the expert Implementatie van herstelondersteunende zorg in de GGz door Simon Bradstreet GGZ Nederland heeft in augustus 2008 het visiedocument Naar herstel en gelijkwaardig burgerschap

Nadere informatie

B1 Woordkennis: Spelling

B1 Woordkennis: Spelling B1 Woordkennis: Spelling Bestuderen Inleiding Op B1 niveau gaan we wat meer aandacht schenken aan spelling. Je mag niet meer zoveel fouten maken als op A1 en A2 niveau. We bespreken een aantal belangrijke

Nadere informatie

Understanding and being understood begins with speaking Dutch

Understanding and being understood begins with speaking Dutch Understanding and being understood begins with speaking Dutch Begrijpen en begrepen worden begint met het spreken van de Nederlandse taal The Dutch language links us all Wat leest u in deze folder? 1.

Nadere informatie


WEBSITE LINK: DPA: Autoriteit Persoonsgegevens (Netherlands) TITLE: DATE: 26 July 2016 KEY WORDS: privacy shield, Article 29 working party, international transfers, Safe

Nadere informatie

Eumedion symposium Nederland vestigingsland aantrekkelijk voor beleggers én ondernemingen

Eumedion symposium Nederland vestigingsland aantrekkelijk voor beleggers én ondernemingen Eumedion symposium Nederland vestigingsland aantrekkelijk voor beleggers én ondernemingen Belastingen: het dilemma van het betalen van een fair share en de verschillende voorkeuren van aandeelhouders en

Nadere informatie

Homework assignment 7 (Intensionality)

Homework assignment 7 (Intensionality) Homework assignment 7 (Intensionality) Semantiek 2013 Solutions Opgave 1 Bekijk de volgende zinnen: A. Lewis Carroll is Charles Dodgson, en Tina ontmoette Charles Dodgson. B. Lewis Carroll is Charles Dodgson,

Nadere informatie

ABLYNX NV. (de Vennootschap of Ablynx )

ABLYNX NV. (de Vennootschap of Ablynx ) ABLYNX NV Naamloze Vennootschap die een openbaar beroep heeft gedaan op het spaarwezen Maatschappelijke zetel: Technologiepark 21, 9052 Zwijnaarde Ondernemingsnummer: 0475.295.446 (RPR Gent) (de Vennootschap

Nadere informatie

De Relatie tussen Mindfulness en Psychopathologie: de Mediërende. Rol van Globale en Contingente Zelfwaardering

De Relatie tussen Mindfulness en Psychopathologie: de Mediërende. Rol van Globale en Contingente Zelfwaardering De Relatie tussen Mindfulness en Psychopathologie: de Mediërende Rol van Globale en Contingente Zelfwaardering The relation between Mindfulness and Psychopathology: the Mediating Role of Global and Contingent

Nadere informatie



Nadere informatie

Growing world shellfish consumption IMPORT: PLAAG OF ZEGEN? European shellfish production

Growing world shellfish consumption IMPORT: PLAAG OF ZEGEN? European shellfish production Growing world shellfish consumption 4. World per capita consumption, source: FAO IMPORT: PLAAG OF ZEGEN? Jaap Holstein Holstein Consultancy kg/capita 3.5 3. 2.5 2. 1.5 1..5. 1961-197 1971-198 1981-199

Nadere informatie

Het Europese perspectief van de oncologieverpleegkunde

Het Europese perspectief van de oncologieverpleegkunde Het Europese perspectief van de oncologieverpleegkunde Erik van Muilekom MANP, OCN, RN Verpleegkundig specialist Antoni van Leeuwenhoek ziekenhuis- Nederlands Kanker Instituut Amsterdam President European

Nadere informatie

TE HUUR. Kazernestraat 31 D 2514 CR 's-gravenhage p.m. ex.

TE HUUR. Kazernestraat 31 D 2514 CR 's-gravenhage p.m. ex. TE HUUR Kazernestraat 31 D 2514 CR 's-gravenhage 2.750 p.m. ex. KENMERKEN Prijs 2.750 p.m. ex. Postcode 2514 CR Ligging In centrum Woningtype Penthouse Woonruimte 110m² Inhoud 330m³ Kamers 3 Oplevering

Nadere informatie

Dutch survival kit. Vragen hoe het gaat en reactie Asking how it s going and reaction. Met elkaar kennismaken Getting to know each other

Dutch survival kit. Vragen hoe het gaat en reactie Asking how it s going and reaction. Met elkaar kennismaken Getting to know each other Dutch survival kit This Dutch survival kit contains phrases that can be helpful when living and working in the Netherlands. There is an overview of useful sentences and phrases in Dutch with an English

Nadere informatie

NIEUWSBRIEF 4. 6 september 2013. Opzegging 2de termijn schooljaar 2013-2014. Schooljaar 2013-2014 INHOUD

NIEUWSBRIEF 4. 6 september 2013. Opzegging 2de termijn schooljaar 2013-2014. Schooljaar 2013-2014 INHOUD Schooljaar 2013-2014 NIEUWSBRIEF 4 INHOUD Ø Directie Ø Prof Dr. J.P. Balkenende Ø Toegang tot school Ø Add school emails to safe sender list Ø Ouderinformatieavond basisschool Ø NSA Ø Adviesraad Ø NCA

Nadere informatie

Cornelis Hermannus Rijnvis

Cornelis Hermannus Rijnvis Cornelis Hermannus Rijnvis Cornelis Hermannus met zoon Cornelis Hermannus ± 1930 Cornelis Hermannus Rijnvis begon in 1922, vanuit de Kerkstraat 67 te Hoogeveen, een transportbedrijf met een bodedienst

Nadere informatie

Financieren van het wonen

Financieren van het wonen Financieren van het wonen Paul de Vries, Rabobank 31 oktober 212 Kennis en Economisch Onderzoek Funding cap Spaargeld Eigen vermogen Kredietrisico Swaptarief Investeerders Hoe

Nadere informatie

Invloed van het aantal kinderen op de seksdrive en relatievoorkeur

Invloed van het aantal kinderen op de seksdrive en relatievoorkeur Invloed van het aantal kinderen op de seksdrive en relatievoorkeur M. Zander MSc. Eerste begeleider: Tweede begeleider: dr. W. Waterink drs. J. Eshuis Oktober 2014 Faculteit Psychologie en Onderwijswetenschappen

Nadere informatie

Waardering van een Onderneming

Waardering van een Onderneming Waardering Congres Financieele Dagblad: Private Equity in de Praktijk 6 april 2006 Dr Michel van Bremen Partner First Dutch Capital B.V. Waardering, essentie: Res tantum valet quantum vendi potest Iets

Nadere informatie

De Relatie Tussen de Gehanteerde Copingstijl en Pesten op het Werk. The Relation Between the Used Coping Style and Bullying at Work.

De Relatie Tussen de Gehanteerde Copingstijl en Pesten op het Werk. The Relation Between the Used Coping Style and Bullying at Work. De Relatie Tussen de Gehanteerde Copingstijl en Pesten op het Werk The Relation Between the Used Coping Style and Bullying at Work Merijn Daerden Studentnummer: 850225144 Werkstuk: Empirisch afstudeeronderzoek:

Nadere informatie

Geïntegreerde ex ante impactanalyse bij de Europese Commissie

Geïntegreerde ex ante impactanalyse bij de Europese Commissie Geïntegreerde ex ante impactanalyse bij de Europese Commissie Peter Lelie Europese Commissie - DG EMPL 7-Oct-09 Directoraat-Generaal for Werkgelegenheid, Sociale Zaken en Gelijke Kansen Eenheid Sociale

Nadere informatie

Landelijk Diabetes Congres 2016

Landelijk Diabetes Congres 2016 Landelijk Diabetes Congres 2016 Insuline Pompen, zelfcontrole en sensoren, need to know Thomas van Bemmel, Internist Gelre Ziekenhuis Apeldoorn Disclosures (potentiële) belangenverstrengeling zie hieronder

Nadere informatie

Tic Toc Choc de Couperin AU, 2007, 3 Elise Mc Leod...2. His Masters Voice/Their Masters Voice NL, 2008, 5, Hans Hylkema...2

Tic Toc Choc de Couperin AU, 2007, 3 Elise Mc Leod...2. His Masters Voice/Their Masters Voice NL, 2008, 5, Hans Hylkema...2 Contents TicTocChocdeCouperinAU,2007,3 EliseMcLeod...2 HisMastersVoice/TheirMastersVoiceNL,2008,5,HansHylkema...2 TachometerDE,20081,PhilipBussmann/SarahHuby...2 BeguineNL,2009,4,DouweDijkstra...2 FlowNL,2008,4

Nadere informatie

Expertise seminar SURFfederatie and Identity Management

Expertise seminar SURFfederatie and Identity Management Expertise seminar SURFfederatie and Identity Management Project : GigaPort3 Project Year : 2010 Project Manager : Albert Hankel Author(s) : Eefje van der Harst Completion Date : 24-06-2010 Version : 1.0

Nadere informatie Date: Wed, 21 May 2008 04:36:48-0700 (PDT) "Fam. R. Sloots" vraag t.a.v. Minor Change Certificatie

Nadere informatie

Ggo's in bio? Nee, dank je!

Ggo's in bio? Nee, dank je! 1/ 5 Ggo'sinbio?Nee,dankje! Genetischgemanipuleerdeorganismen(ggo s)wordenstilaandenieuwetrendinhetlandbouwtechnologisch onderzoek.zolijkthet.tegelijkertijdwordencontinutegenstrijdigeberichtendewereldingestuurd.dekennisover

Nadere informatie

Examenreglement Opleidingen/ Examination Regulations

Examenreglement Opleidingen/ Examination Regulations Examenreglement Opleidingen/ Examination Regulations Wilde Wijze Vrouw, Klara Adalena August 2015 For English translation of our Examination rules, please scroll down. Please note that the Dutch version

Nadere informatie

Qualcomm mei 2015. Galerijke Turnhout. Update

Qualcomm mei 2015. Galerijke Turnhout. Update Qualcomm mei 2015 Update Qualcomm mei 2015 One of the world's largest semiconductor producer and the largest provider of wireless chipset and software technology, Chipset is een in de computerbranche vaak

Nadere informatie

De economische impact van arbeidsmigratie uit de MOE-landen, Bulgarije en Roemenië

De economische impact van arbeidsmigratie uit de MOE-landen, Bulgarije en Roemenië Amsterdam, december 2008 Onderzoek in opdracht van het Ministerie van Sociale Zaken en Werkgelegenheid De economische impact van arbeidsmigratie uit de MOE-landen, Bulgarije en Roemenië Een studie naar

Nadere informatie

Three years Short Sell Regulation

Three years Short Sell Regulation Three years Short Sell Regulation Publication date: 3 November 2015 The Netherlands Authority for the Financial Markets The AFM is committed to promoting fair and transparent financial markets. As an independent

Nadere informatie

Dashboard. 1 Nov 2011-30 Nov 2011 Comparing to: Site. 27.14% Bounce Rate. 409 Visits. 2,197 Pageviews. 00:02:58 Avg. Time on Site. 5.

Dashboard. 1 Nov 2011-30 Nov 2011 Comparing to: Site. 27.14% Bounce Rate. 409 Visits. 2,197 Pageviews. 00:02:58 Avg. Time on Site. 5. Dashboard 1 Nov 211-3 Nov 211 4 4 2 2 Site Usage 49 27.14% Bounce Rate 2,197 Pageviews :2:58 Avg. Time on Site 5.37 Pages/Visit 69.44% % New Traffic Sources Overview Map Overlay Direct Traffic 293. (71.64%)

Nadere informatie


CUSTOMIZE YOUR APPLE AND PRESENT A UNIQUE COMPANY GIFT CUSTOMIZE YOUR APPLE AND PRESENT A UNIQUE COMPANY GIFT Ready for customization according to your companies wishes? The Royal Blue Collection a Custom Made collection. This is the perfect combination of

Nadere informatie

Hoe slimmer, hoe eerder dom!

Hoe slimmer, hoe eerder dom! Management Studiecentrum congres: De wereld van communicatie: Hoe slimmer, hoe eerder dom! De dynamiek van de kenniseconomie Steeds snellere veroudering van vakdeskundigheid Mathieu Weggeman, Rotterdam,

Nadere informatie

Rijksuniversiteit Groningen. Posters. versie 2.0

Rijksuniversiteit Groningen. Posters. versie 2.0 Rijksuniversiteit Groningen Posters versie 2.0 INHOUD zwart-wit posters (print) 3 zwart-wit posters (print) instructies 10 full colour posters (drukwerk) 14 full colour posters (drukwerk) instructies 22

Nadere informatie

ADHD & bioritme. ADHD & Vrouw 7 maart 2015. Marjolein Tanke

ADHD & bioritme. ADHD & Vrouw 7 maart 2015. Marjolein Tanke ADHD & bioritme ADHD & Vrouw 7 maart 2015 Marjolein Tanke ADHD & bioritme vrouwen slapen slechter dan mannen - kwalitatieve wisselend i.v.m. hormonen - meer moeite met inslapen (In 70% van ADHD

Nadere informatie

Voorkom pijnlijke verrassingen Nieuwe Controleaanpak Belastingdienst. Presentator: Remko Geveke

Voorkom pijnlijke verrassingen Nieuwe Controleaanpak Belastingdienst. Presentator: Remko Geveke Voorkom pijnlijke verrassingen Nieuwe Controleaanpak Belastingdienst Presentator: Remko Geveke Start webinar: 08:30 uur Agenda Nieuwe Controleaanpak Belastingdienst Verticaal Toezicht vs. Horizontaal Toezicht

Nadere informatie

Uitgifte nieuwe circulatie- en herdenkingsmunten

Uitgifte nieuwe circulatie- en herdenkingsmunten (Scroll down for the English version) Persbericht 2014-005 Uitgifte nieuwe circulatie- en herdenkingsmunten Willemstad - Ter gelegenheid van de eerste Koningsdag op 27 april 2014, wordt op vrijdag 25 april

Nadere informatie