DRIEMAANDELIJKSE UITGAVE. Nr ste Jaargang Januari februari - maart REVUE TRIMESTRIELLE. N 1 35 ième Année Janvier Février Mars 2015

Save this PDF as:
 WORD  PNG  TXT  JPG

Maat: px
Weergave met pagina beginnen:

Download "DRIEMAANDELIJKSE UITGAVE. Nr. 1-35 ste Jaargang Januari februari - maart REVUE TRIMESTRIELLE. N 1 35 ième Année Janvier Février Mars 2015"

Transcriptie

1 België Belgique P.B Steenokkerzeel P DRIEMAANDELIJKSE UITGAVE Nr ste Jaargang Januari februari - maart REVUE TRIMESTRIELLE N 1 35 ième Année Janvier Février Mars 2015 UIT EN THUIS AMICALEMENT VOTRE Verantwoordelijke uitgever : Editeur Responsable : IMSO-team Uitgiftekantoor : Vanheylenstraat 16 Bureau de distribution : 1820 Melsbroek 1820 Steenokkerzeel

2 INHOUDSTAFEL / SOMMAIRE OverzichtSommaire 3 NieuwsNousontquittés 4 NieuwsvandeRaadvanBestuur 5 WorldMSDayop27mei MedicinalecannabisenMS 7 GutenTag,Bonjour,GoedenDag, 8 Marc 11 InterviewmetdeheerJeanLouisBerodes 12 Feestkalender 19 Uitnodigingophet15 de Kippenfestijn 20 SWIMSO Puzzelensudoku 22 AnniversairesVerjaardagen 26 NouvellesduConseild Administration 28 CannabisàdesfinsthérapeutiquesetS.E.P. 29 JournéemondialedelaMS 30 InterviewdeMonsieurJeanLouisBerodes 31 SWIMSO HiEveryone 39 DiscourspourledépartdeGuyGanty 41 Calendrier PuzzleFrançais 43 Sudokunouveaunieuw 45 Résultats/uitslagen 47 IMSO 2014/4 2

3 OVERZICHT Dat er geen zekerheden zijn in dit leven. ons moet je het niet meer vertellen. Getuige hiervan is het interview met de Heer Jean-Louis Berodes en ook het eerder pijnlijke verhaal van Marc. Zelfs bij IMSO blijft niet alles wat het was. Vergeet niet te noteren dat de World MS Day dit jaar in België doorgaat op 27 mei Voorts wordt het hete hangijzer MS en Cannabis behandeld. Ook Sarah doet hier haar verhaal in het Nederlands, wees dus niet te kritisch. IMSO maakt ook graag reclame voor SWIMSO U toch ook? A.W. SOMMAIRE Cher lecteur, vous trouverez d abord la liste des personnes qui nous ont quittés et la liste des anniversaires. Vous aurez ensuite des nouvelles du Conseil d Administration de l I.M.S.O. Suit un article sur le cannabis à des fins thérapeutiques. Puis il est question de la journée mondiale 2015 de la MS. Elle aura lieu cette année à Walibi. L interview de Monsieur Berodes vous tiendra en haleine. Cenkal, notre nouveau bénévole au cybercafé, nous présente son portrait et nous parle de son pays, la Turquie. Juste avant cela, vous aurez eu sous les yeux le faire-part de notre «swimmarathon» Il s agit d une épreuve où les nageurs se font sponsoriser Elle a lieu chaque année et se fait au profit des patients, dans le cadre des activités de l I.M.S.O.. Bonne lecture. Y.L. IMSO 2014/4 3

4 Overleden Nous ont quittés Mevrouw Aloïsette VRINDTS Geboren te Blaasveld op 22 juli 1937 Overleden te Melsbroek op 2 december 2014 Madame Maria-Fernanda SEGURA-PENA-SIMAO Née le 24 mars 1962 à Castro Marin (Portugal) Décédée le 29 décembre 2014 IMSO dankt zeer hartelijk de talrijke medewerkers aan de SWIMSO 2015 IMSO remercie de tout coeur les nombreux participants au SWIMSO 2015 IMSO 2014/4 4

5 NieuwsvandeRaadvanBestuur DejaarlijksereisnaarhetZuiden. SindsvelejarenheeftIMSOeenjaarlijksereisnaarhetZuidengeorganiseerd, meestaleindseptember/beginoktoberomdegrotewarmteendehogere kostprijstevermijden. Vóór2000washetvoorzitterPolVanVlasselaerdieditinitiatiefheeftopge start.inzijntijdgingdereismeestalnaarspanjeengebeurdedeverplaatsing metdebus,watlokalebezoekentoeliet. Deelnamevandepatiëntwasslechtsmogelijkindienhij/zijvergezeldwas vaneenpartnerdiedepatiëntkonbijstaanvoorzijnmogelijkeverzorgingen verplaatsingen. Vanaf2000werddezefunctieovergenomendoorChristelenBrigitte,nadien doorbrigitte.dereisgingnumeestalnaarturkijeensomsnaarspanje,tel kenspervliegtuig. Delaatstejarenwerddeorganisatiestedsmoeilijker.Overbookingdoorreis agentschappenwarenerdeoorzaakvandatweterplaatsenietoverhetno digeaantalaangepastekamerskondenbeschikken.ookwerddegraadvan zelfredzaamheidvandepatiëntengeleidelijkzwaarderwatvoorpartnersen begeleiderssteedsmeerinspanningvroeg. DaarbijkwamnogdatBrigittemetpensioengingenzichnietmeerincondi tieachtteomdeverantwoordelijkheidvandeorganisatieopzichtenemen. GeziendezeomstandighedenbeslistedeRaadvanBestuuromditinitiatiefte stoppenenhet,indienervraagnaaris,eventueeltevervangendoortwee maalperjaareendaguitstap. HetverblijfaanzeeinhethotelSandeshoved Nellyrapporteertdatin2014debezettingvandeangepastekamerinSades hovedreedssterkistoegenomentegenovervorigjaar. Tenoverstaanvan2013stijgdedebezettingmet9weekends.Openkeleop merkingennawarendebezoekerstevredentotzeertevreden. Opaanvraagvanonzesponsor,deRotaryClubvanZaventem,zalChristel samenmetnellyhieroververslaguitbrengeninéénvanhunvolgendever gaderingen. IMSO 2014/4 5

6 Together we are stronger than MS In2015wordthetaccentvandezeMSWerelddaggelegdopdeuitwisseling vaninformatieoverdegeboektevooruitgangindesocialeintegratievande PersoonmetMSenzijnfamilie.Allemiddelendieinverschillendelanden hebbengeleidtotmeerlevenskwaliteitzullenhierbijaanbodkomen. DeLigaMSVlaanderenverstrekteonshierovervolgendeinformatie: DeMSWerelddag2015heeftditjaarplaatsinBelgië,inhetWalibipret parktewaver,opwoensdag27/05/2015. DezeinternationalesensibiliseringsdagvoorMSwordtoplokaalvlakgeor ganiseerddoordebelgischenationalemsligainsamenwerkingmetde VlaamseMSLigaendeFranstaligeMSLiga.Zeverwachteneengoedepu bliekeopkomstmaarinhetbijzonderookvanmspatiëntenenhunfamilie, vanuitbinnenenbuitenland. HetNationaalMSCentrumMelsbroek(NMSC)zalactiefdeelnemenenheeft reedszijnaanwezigheidmeteenaantalmspatiëntenenpersoneelsleden toegezegd.alssponsoringactiviteitwordtereenmaaltijdvoorvipsgeorga niseerdmetmuzikaaloptredenenuitreikingvanprijzenvoordemeestsoci aalingesteldefirma. Detoegangsprijsvoordeheledagisnormaal25 maarvoorledenenfami lieledenzoudeligaeengunstprijsvan10 toestaan. AanIMSOwordtergevraagdomdezesamenkomstaantekondigenente ondersteunendoorhaardeelname. htps:://tweeter.com/worldmsday. IMSO 2014/4 6

7 MedicinalecannabisenMS Dezemateriekwamdelaatstewekengeregeldindepers.Deartsenvanhet NMSChebbenhunmeninghieroverbekendgemaakt. Dezewerdsamengevatengepubliceerdin Indekijker Nieuwsbrief van ,opdewebsitevanhetNMSC:www.mscenter.be Onzeartsenwenseneenenanderteverduidelijkeninverbandmetdebe richtendieeind2014indemediaverschenenoverdebehandelingvanms metmedicinalecannabis. Vooreerstdienenweoptemerkendathetenkeleenvoorstelbetrefttotop maakvaneenkoninklijkbesluit,omcannabisverkoopbaartemakenviade apotheek.hetlegalegebruikismomenteeldusnognietaandeorde. Hethoofdbestanddeelvancannabis,namelijkcannabinoïden,zoubeschik baargesteldwordenonderdevormvaneenspray.inenkeleanderelandenis ditalbeschikbaar.wewillengraagverduidelijkendatcannabisslechtseen vandevelemogelijkesymptomenvanmskanreduceren,namelijkpijnlijke spasticiteit. Dejuisteplaatsindebehandelingvanspasticiteit,veroorzaaktdoorMS, dientnogbepaaldteworden. Naaronsaanvoelenzullenanderebehandelopties,zoalskinesitherapie,me dicatietegenspasticiteitenijsapplicaties,eenbelangrijkeplaatsindebehan delingvanspasticiteitbehouden. Cannabinoïdenondervormvaneensprayhebbenimmersooknevenwerkin gen.verderisdemogelijktoekomstigebeschikbaarheidvanhetproductgeen redenomhetbeleidi.v.m.cannabisinhetnmscteveranderen. Weherhalendathetgebruikvancannabiseennegatieveinvloedheeftopde algemenegezondheidenophetverloopvanmultiplesclerose.drugs,zoals cannabis,blijvendaaromvolledigverbodeninhetnationaalmscentrum. IMSO 2014/4 7

8 Melsbroek, Guten Tag, Bonjour, Goeden Dag, Ik ben Sarah. Ik ben vrywilliger en ik werk all zinds zes maanden hier in de MS-Klinik in het Cybercafé. Ik denk dat de meeste mensen mij nu kennen. Niettemin is het misschien goed nog en beetje meer over mij te weten. Dus stell ik mij nu nog een keer voor. Ik ben met mijn tweelingbroer, mijn ouderen broer en mijn ouders in Dietkirchen, een klein dorpje naast Limburg a.d. Lahn, in Duitsland groot geworden. Daar heb ik 18 ½ jaar geleefd en geleerd. Met 18 jaar heb ik laatste jaar mijn humoniora gedaan en dan wilde ik weg... Dat is eigentlijk remakkelijk. Maar het heeft niet zo met de unis in Duitsland gelukt. Dus heb ik spontaan een applicatie versuurd. Binnen twee uuren heb ik een positief antwoord van Melsbroek gekregen : U bent binnen! Zo noem ik dat nu ook.... Binnen voor een jaar! Vanaaf dan start mijn belgisch avontuur. Binnen acht dagen ben ik dan ook verhuist in de klinik in mijn mooie kamer, die toch heel leeg was. Met de help van mijn ouders is ze rap erg vol gewor- IMSO 2014/4 8

9 den. Zoals mijn kamer nu mijn niew home was, zijn het ook heel rap de klinik en de patienten geworden. Achter de on-arrival-training, waar ik de anderen 40 vrywilligen uit Belgie ontmoede heb, en de een of andere keer naar het jeugdhuis van Melsbroek ging, is ook mijn vrije tijd goed organisierd. Omdat jullie mij ook allemaal verstaan en ik jullie, volge ik twee keer de week nederlandsless in Leuven. Straks heb ik level 1 en ik hoop binnen het zomer met level 3 aftesluiten. Maar voor alle franstalige: J assaie, hé?! Maar dat is niet het einige wat ik geleerd heb.... Ik zie jullie elke dag zoals voorbeeld om het leven te nemen zoals het koomt. Davoor ook nog een grote chapeau! Volgend semptember zal ik spijtig genoeg mijn jaar hier beeindigen. Dan wil ik graag psychologie studeren en dat later met logopädie kombeneren. Dan ben ik terug weg van en home. Maar dat mooie van een home is dat men altijd terug komen mag.... Nu hoop ik dat de volgende zes maanden met jullie verder leerrijk en pleazant zullen zijn! Lieve groetjes en XXX! Jullie Sarah Gockeln PS: Volgende laat ik jullie nog enkele foto s zien, een in Limburg a.d. Lahn, mijzelf met andere europese vrijwilligers in Belgie, en een ander van mijzelf in Brussel : IMSO 2014/4 9

10 N.B. Op vraag van de redactie heeft Sarah haar bijdrage in het Nederlands geschreven, een prestatie na 6 maaden verblijf in Melsbroek. Intussen is ze in heel het NMSC goed bekend en erg gewaardeerd. IMSO 2014/4 10

11 MARC Zijn vrouw ging niet werken en hij wilde toch in een riante villa in het bos wonen. Hij had dus elke week een dubbele opdracht in het onderwijs,wat in die tijd nog mogelijk was. Een jaar vóór zijn terbeschikkingstelling zag hij het weer helemaal zitten. The sky was the limit. De bomen groeiden tot in de hemel.binnenkort mocht alles en moest er niets meer. Elke dag zijn hobby, het schilderen, beoefenen. Dagelijks een stevige boswandeling met de hond én een natje of een droogje in een plaatselijke kroeg of afspanning. Welgeteld drie maand is het goed gegaan. Toen sloeg het blinde noodlot toe. Een hersenbloeding maakte een brutaal einde aan alle illusies en dagdromen. Hij kan niet meer spreken en herkent je nog nauwelijks. Hij woont nu in een bejaardentehuis, vijftig meter voorbij de bocht opzij van zijn huis. Soms bezoeken we hem wel eens, maar dan zie ik alleen treurnis en narigheid. Thuis zie ik weer de échte Marc, de leperd die als een schaamteloze Reinaert de Vos de gebreken van een ander uitbuitte en / of tot eigen voordeel aanwendde. Hij durfde letterlijk alles. In volle les kwam hem eens de inspecteur opzoeken. Dat zinde hem helemaal niet. Die ochtend was dat voor hem een brug te ver. Hij legde tien minuten lang de theorie van Adam Smith uit, duwde het krijtje in de handen van de ander en zei ijzig kalm: En nu zal meneer de inspecteur jullie de rest vertellen. En die dééd dat nog ook. Hadden de leerlingen het ons niet verteld, we hadden het nooit geloofd. Als hij zijn zinnen op iets had gezet, haalde hij zijn slag thuis. Daar kon je gif op innemen. Zo heeft hij ooit een trip versierd naar een vakantieverblijf mét rondleiding en gratis etentje.hij deed het altijd op dezelfde manier, mét een kleine variant. En iedereen wist dat én tuinde er met muil en poten in. Als een paling in een emmer groene zeep gleed hij door de vingers. Op een dag de computer was nog jong, 1984 of zoiets- had hij er schoon genoeg van punten op te tellen en gemiddeldes te berekenen. Hij trok naar de juiste man, de pater computer m.a.w. en begon die stroop om de baard te smeren. Hij als doctor in de wiskunde wat niet waar was! was als enige in de hele streek in staat een systeem te ontwikkelen dat alle uitslagen van alle klassen kon uittellen en het percentage per leerling kon berekenen. En dat zelfs nog vr de proefwerken begonnen. Iedereen kon de ander zien groeien. Elk woord maakte hem een centimeter groter. De volgende dag had hij de klus geklaard. De hele nacht had hij eraan gewerkt. IMSO 2014/4 11

12 Maar er was méér: per leerling had hij zijn gemiddelde en behaalde plaats voor dagwerk, proefwerk en totaal uitgerekend. Het systeem stond op poten. Zonder een spier te vertrekken, begon de ander de loftrompet te steken : Ach, Jef, het spreekwoord is duidelijk : Olie drijft altijd boven. Zoiets kan jij alleen. De anderen lachten, maar gingen volmondig akkoord. Het jammerlijke was echter dat hij géén maat kende.hij deed het ook als de tegenstander te licht uitviel. Zo hadden wij bij het CLB een assistent die zijn taak erg ter harte nam en die op een dag zelf voorstelde een klassenraad bij Marc te komen bijwonen. Zoals altijd bestond die raad uit 3 personen: de klassenleraar (Marc dus) en 2 leraren die in die klas onderwezen. Elke week werden leef- en leerattitudes van een aantal leerlingen besproken. Maar Marc zag de ander enkel als een pottenkijker en als hij ergens het land aan had, was het wel dat. Als vergaderplaats had hij een werktafel van de lerarenkamer uitgekozen. De ander zat al op hete kolen. Marc echter haalde een spel kaarten tevoorschijn en bromde : René, ken jij iets van whist? Die wilde zijn goede wil en kennis van dit volksvermaak tonen en zei op gretige toon: Ja, natuurlijk. Wel, we beginnen hier altijd nogal ludiek, de boog kan tenslotte niet altijd gespannen staan. Eén frank per slag, bij troel is de vierde aas troef. René was volledig uit het veld geslagen en accepteerde totaal beduusd zijn eerste vier kaarten. Hij ging met een bolle rug naar de ingang zitten en hield zijn dertien kaarten gebogen als een leerling die zijn buur wil verhinderen te spieken. Het eerste partijtje verliep rimpelloos. Het tweede begon. Maar er kwam een abrupt einde aan de pret. De directeur kwam in een sigarenwolk naar binnengeschreden. Zoals Reinaert bij Tibeert, haalde Marc de strop om de hals van de overijverige druiloor dicht. Pater directeur, René zit hier begot te kaarten, als ze dat ook al klassenraad noemen. De ander viel als een kat op zijn poten en antwoordde streng : Dat moet ik tegen zijn directeur zeggen. René voelde zich op heterdaad betrapt en mompelde iets van niet de gewoonte en abnormaal en zo. De baas vond dan weer dat iedereen zoiets kon zeggen en alle anderen beaamden dat. En dat doe je al eens iets voor de toenadering tussen het CLB en de school en dan hebben ze je z liggen. Marc van zijn kant heeft nooit meer last gehad van ongewenste indringers. André W. Onze leraar heette Frans Engels.Heel zijn leven had hij zijn Latijn gestoken in het geven van Duits en nog bleef het Grieks voor ons.(a.w.) IMSO 2014/4 12

13 InterviewmetdeHeerJeanLouisBERODES IkontmoettehemtoenhijzichverplaatsteindegangenvanhetCentrum,tijdensde maanddecemberll.,wanneerikdaarwasvoordeverdelingvandekerstgeschenken. IMSOorganiseertditiederjaarvoordepatiënten. Hijverteldemetoendathijvoorheteerstgehospitaliseerdwasvooreenverblijfvanenke lewekenvooreenrevalidatiebehandeling. Snelontstondtussenonseenvertrouwdeomgangenweverlietenelkaaralsvrienden. NaeenkortetijdvertrouwdeJeanLouismezijnmeestintiemebezorgdhedenaangaande zijnziekteendeweerslagopzijnfamiliaalleven. Ikliethemmaarzijnhartuitstorten.Ikvoeldedathijhetnodighadensteldehemvoordat hijzijngevoelensmaareensvolledigineeninterviewzouweergevenvoorhetimso tijdschrift.hijaanvaarddeditvoorstelmetenthousiasme. DitinterviewgingdoorinzijnwoonstteKoekelberg,indeaanwezigheidvanzijnechtge note. Yvon Laatonseerstpratenoveruwopleiding,inuwfamiliaalmilieu. J.L. Mijnvaderwaspolitieagentenmijnmoederkapster.WevertrokkennaarBelgisch Kongo(N.B.J.L;wastoenzesjaar)gedurendedriejaarvan1957tot1960. Nadienvervolledigdeikmijnlagereschoolendanmiddelbaartechnischonderwijs. Ikwasinderdaadmeerpraktischaangelegdenmijnkeuzegingooknaarhandenarbeid.Ik hebmijnstudiesbeëindigdin1968.hetzelfdejaarbenikmegaanbekwamenindecarros seriebijdefirmaopelmabile,gelegenopdegentsesteenweg,eerstalsleerjongen. In1969deedikmijnlegerdienstenin1970hernamikmijnopleidingindecarrosserieen werdplaatwerkervanaf1970. In1974werdikaangesteldindeEuropeseUniealsdeurwaardermethetstatuutvanlo kaalagent.nadienhebikeenvervolmakingcursusgevolgd.nahetafleggenvaneenexa menwerdikbenoemdalsambtenaarenlaterbeniktrapsgewijsverderinmijnfunctieop geklommen. Y. Danhadhetnietsmeertemakenmetwerktuigkunde!Hoekwamjeertoeomvan werkteveranderen? J.L. Hetwastewijtenaandeeersteoliecrisisin1973enmijnvaderzeitoen: Luister goed,hetgaatslechtindegarages..gezienikindewijkvandeeuropesegemeen schappenwoonde,hadikvernomendatmenovergingtotdeaanwervingvanlocaleagen ten.endanbenikmemaargaanaanbiedenzonderveelzinwantikdeedzeergraagmijn werkalsplaatslager.ikhebmeergoedingewerktenheberuiteindelijkmijnloopbaan beëindigd.ikheber35jaargewerkt,duseenvolledigeloopbaan,opverschillendeposten, altijdwelopadministratieenaltijdindepersoneelsdiensttoteind2009. Y. Laatonseventeruggaanindetijd.Vormdejesneleenkoppel? IMSO 2014/4 13

14 J.L. Ja,wehebbenelkaarontmoetin1971enwezijngetrouwdin1972.Ditisnu43jaar geleden. Y. Hebjekinderen? J.L. WehebbentweekinderenuitIndiaaangenomen.Wezijnzegaanzoekeninde krotwijkenvanbombay,eersteenmeisjevan2,5jaarendriejaarlaterhaarbroertje. Y. Hadjenoganderekinderen? J.L. Helaasniet. Y. Jesprakmevanjezoon. J.L. Hijpleegdezelfmoord,hijmaakteeeneindeaanzijnlevenomdathijleedaanschi zofrenie.gedurende8,5jaareenechtelijdensweg.(nb:eensterkemotioneelmoment). Y. Hadjemeerderevrienden? J.L. Ja,veelkennissenenveelvriendenlangsdekantvanmijnvrouw.Ikhebeenvriend metwieikalopdelagereschoolzatin1964. Y. En,eensjeziekwerdwelkeplaatsnamentoenjevriendenin? J.L. Demeestenhebikbewaard.Weblijvenincontact. Y. Minderdanvroeger? J.L. Ikverplaatsmeookminder. Y.Laatonsterugkerenopuwjeugd:hoeisdieverlopen? J.L. Helemaalnormaal.Ikhoordemijnoudersnooitruziemaken. Y. Hetlevenvantoen,beschouwdejedatlevenalshet«echteleven»endat,sindsjeaan MSlijdt,nietmeerhet echte? J.L. Neen,helemaalniet.Erisweleenlevenvanvoordieneneenvannadien.Ikhebme aangepast.toendeprofessorvanhetersamusziekenhuis,nadathijmediagnosehad meegedeeld,megezegdheeft: Komterugopraadplegingbinnen6maanden,jezultdat welverteren.watikgedaanheb?ikhebikmediepbezonnenoverwatikallemaalheb kunnenmeemakenvoordien, watjongemensenmetdediagnoseniethebbenkunnen meemaken.uiteindelijkwerdbijmijslechtsdediagnosegesteldopdeleeftijdvanonge veer50jaar.erzijnaljongerendiedatallemaalmeemakenop25jarigeleeftijd.alsikdan devergelijkingmaak hebikeengelukkigejeugdgekend. Y. Levenvoorjezelf,heeftdatzinvoorjou? J.L. Neen,ikleefvooranderen.Watikvooralmisisdatikanderennietkanhelpen. Ikkannogwelhelpenmaar.nietmeerfysiek. Y. Uweigenwaarde?Hebjenogvertrouweninjezelf? J.L. Ja! IMSO 2014/4 14

15 Y. Welkezijnjefilosofischeenreligieuzeovertuigingen? J.L. Ikbenkatholiek,ikwerdgedoopt,hebmijneersteenplechtigecommuniegedaan, wezijngetrouwdvoordekerk Y. Benjegelovig? J.L. Ja,maarnietpraktiserend.(N.B.:lateruitzijnverhaalwerdduidelijkdatJ.L.gelooft inhetbestaanvanjezusmeerdaningodendathijeengrootbewonderaarengrootvol gelingwasvanjezusenzijnleer.) Y. Hebjenogsteedsvelevrienden? J.L. Ja,ikhebeenvriendinhetCentrumwaarmeeiknogaltijdcorrespondeer,nl.de heerluclemaire.(n.b.:y:ikkenhemwelenhebj.l.gelukgewenstmetzijnkeuze.) Y. Hoewasjeverhoudingt.o.v.geldenmateriëlebezittingen? J.L. Ikdenk,zoalsdemeestemensen:wanneerikbehoeftehadaaneenfiets,eenwagen kochtikhem.neen,geldiszekergeendoelopzich. Y. Watbondjeaanhetleven? J.L. Mijnfamilie,mijnkinderen,mijnvrienden.Enikmoetzeggen,hetisnogaltijdzo. Y. Hadjegrotemateriëlebehoeften? J.L. Neen,erzijnmensendienooitgenoeghebben.Onzezorggingvooralnaaronze kinderen. Y. Waaraanbesteeddejehoofdzakelijkjegeld? J.L. Aanvrijetijdsbesteding,vakantie,wegaangraagoprestaurant.Wehelpengraagon zeverwanten,onzekinderen,zelfssommigefamilieledendiehetmoeilijkhebben. Wehaddenkunnenrijkzijn,nogmeteenhuiskunnenmaardatalleswasvanminderbe langvoorons.welvonden,mijnvrouwenik,hetfijndeglimlachvananderentemogen ervaren,deanderentehelpen. Y.Hadjevelevrijetijdsbezigheden,entijd? J.L. Ja.Onzevrijetijdsbezighedenbestondenuitreizen,cultureleactiviteitenenzwem men. Y. Dusooksport!Namsporteengroteplaatsin? J.L. Ja.Tijdensdelagereschoolgingikveelzwemmen.IkwaslidvaneenclubinAnder lecht,bijceria.ikspeeldeookvoetbalenwasooklidineenpingpongclub.andere sportendiebeoefendewarentennis,tafelvoetbal,kaartenengemeenschapsspelen. Y. Jehadsteedseengoedgevoelvaneigenwaarde,eengoedzelfvertrouwen? J.L. Ja. IMSO 2014/4 15

16 Y. Laatonshetnuhebbenoverjediagnose.Wanneerisdiegesteld?. J.L. Ikmoetzeggendatdeeerstegangstoornissenzijnopgetredenin2004(opmijn53 jaar).ikwerdmebewustdatikgeenverreafstandenmeerkonstappen. Nadienwerdlangdurigrechtstaanmoeilijkenmoestikmijverplaatsenmetdemetroen uiteindelijkmetmijnwagennaarhetwerk. Ikkonnogmoeilijkinmijntuinwerken.Ikmoeststeedskortepauseninlassenengaan zitten. Entoen,bijdeeerstezelfmoordpogingvanmijnzoonin2005,hebbenwegedachtdatdeze krachtverminderingtemakenhadmetvermoeidheid,wantdatwaseenzwareemotionele schok.wehebbentoennietverdergeïnformeerdtot2008. Nadienhebikeenvolledigeoppuntstellingondergaanmeto.a.MRIenhospitalisatiein clusiefmeteenlumbalepunctiegedurendemeerderedagen. Dediagnoseluidde: UlijdtaandeprimairprogressievevormvanMS. Vanaftoenbeniknaarhalftimetewerkstellingovergestapt,gedurendeanderhalfjaar. Ikgingnogenkel smorgensenmoesteengroeplandbouwersbegeleidenmaardatwas tevermoeiend.toenhebbenzemebureelwerkgegevenenvandaarkonikallesbeheren. Y. Ahzo!Dusisallesnogvlotverlopenophetwerk,zehebbenjegoedgeholpen,ze hebbenrekeninggehoudenmetuwhandicap? J.L. Absoluut.Halftimewerkenvoormedischeredenisnormaalbeperkttot6maanden maarvoormijmaaktenzeeenuitzondering;ikmochtnog18maandenlangerwerken. Dearbeidsgeneesheerzeime:«Ubentbijnaopheteindevanuwloopbaan;jehoeftnog slechtsenkelemaandentepresteren».ikdachttestoppenop60maarbeëindigdemijn werkuiteindelijkop58,5jaar. Y. Hadjetijdomjeopruststellingvoortebereiden? J.L. Ja,hetlaatsteanderhalfjaar. Y. Jehadallesvoorzienennagedachtwelkebeslissingenjegingnemen? J.L. Juist.Ja.Nadediagnosestellinghadmijnvrouwalgezegddathetbestwasomons huisteverkopeneneenappartementtekopen.dathadzegoedingeschatwantikwas daargeenvoorstandervan.ikkonnogmijnplantrekkenendetrappenop.neen,zijhad desituatiegoedingeschat. Y. Isjerolindefamilienietveranderdsindsjeziekte? J.L. Neen,helemaalniet.Ikhounogeengroepaanhetwerk.Zekomenmehalenmetde wagen. InZwitserlandisereenlabodateenzeergevorderdmiddelgevondenheeft.Hetkwam reedsopdemarktenhethersteltdemyeline.. IMSO 2014/4 16

17 Y. Ophetvlakvanjepersoonlijkheid:Wathieldjeverbondenmethetleveninde periodevandediagnosestelling? J.L. Ikbleefeenoptimist. Y. Hebbendebeperkingenvanjezelfredzaamheidjenietteveelgestoord? J.L. Neen,ikheballesgoedoverwogenenbesloot:erzijnzakendieiknietmeerkan maarikgadiecompenserenmetanderezaken. Y. Hoehieldjehetvol? J.L. Mijnentourage,mijnechtgenote,mijnbroers,wehebbenookkleinkinderen. Y. Isdeverhoudingtotuwvriendennietveranderd?J.L. Neen. Y. Hadjenooitdewensvoormezelftegaanleven?J.L. Neen. Y. Hadjegeennoodaanaanpassingenthuis?. J.L. Indebadkamergaanweeenbadlift«afkalft»plaatsen.Enikgaookbeschikken overeenortesevoormijnrechtervoet,nl.eenvoetopheffer. Y. Enwatbetreftdevrijetijdsbezigheden? J.L. Iklees,ikgebruikmijnPCéénuurperdag.Ikgaopinternet,opSkype.Ophetwerk wasikniettemoeomdatikopdecomputermochtwerken.ikmoestdeprijzenvande groenten,vanhetvleesnakijken Indiennodigkonikeenberoepdoenopvertalers. Y. Jeondervondveelbegripvanjefamilie,enjeechtgenote? MadameBerodes Ikhadhetermoeilijkmee:deziektevanmijnman,hetoverlijdenvan mijnzoon. J.L. Optweejaartijd,hebbenwedeoudersvanmijnvrouwenmijnoudersverloren. Menbeschiktweloveronverwachtevaardighedenomjeaanoptetrekken. Mengaatdiepzoekeninzichzelfomzichjeweeroptekrikken,omtelevenvooranderen. Wantikleefvooranderen;ikhouvanhetleven,maar. Y. Jegeeftjelevenvooranderen! J.L. Ja,datishet!Eenglimlachvanmijnechtgenotewanneerzetevredenis.Alszeeen lekkeremaaltijdklaarmaakt,uitikmijntevredenheid. Y. Enhetzijnzakendie. J.L. Dievoorsommigenkleine,onschuldigezakenlijken. Y. Maardatisvanbelang. J.L.(N.B.:J.L.komtterugophetverliesvanzijnoverledenzoon) Hijwasbijonsgedu rende29jaar.hijgingaltijdnaastmezittenenwasveelbijons. Doorzijnziektewashijsterkafgezwakt,zeerkwetsbaargeworden.(Stilte). IMSO 2014/4 17

18 Y. Werduwzelfzekerheidnietaangetastwanneerjemetdeziekteachteruitging? J.L. Neen,ikzeihetal,alsikdevergelijkingmaaktemetdejongemensendieikMels broekontmoette,.datheeftmedatversterkt:ikmagnietklagen. Ikkannogveelalleendoen,wanneerikdanvelenziedieafhankelijkzijnvaneenelektro nischerolwagen;diederolstoelzelfmetkinbesturingmoetensturen;dievoorallesde hulpvanderdenmoeteninroepen.endietochnogoverdekracht,demoedbeschikken omhetlevenaantekunnen!want,indienzedatwensen,kunnenzehunlevenverkorten. Nuisdatlegaalmogelijk Fysiekbeschikkenzeovernietsmeermaarhunhersenen werkennogzeergoed.enhunglimlach Y. Denkjedatjereligieuzeovertuigingeenondersteuningbetekent?J.L. Neen. Y. Ishetwatanders? J.L. Ja.Ikhebvoormijzelfhetvolgendeuitgeklaard:Ikgaakkoord.InonzelieveHeer gelovenwij,maarwanneerjezietwatsommigenuitsteken,enzichdoorallesheenkunnen werken dangajedezakenrelativeren.ikbengelovigmaar.ikgeloofmeerinjezus daningod.jezus,datis«iemand». Y. Ja,jebenteen«Jezuïet»JebentzoalsChristiandeDuve HetisomdatJezusons geleerdheefthoewemetelkaarmoetenleven?hoesamenlevenmetelkaar,werdaleer derbesproken. J.L. Latenwedaarverdernietoveruitweiden,maar neembijvoorbeeldwaterzichin Syriëafspeelt:jehebtgeenwoningmeer,geenverzorging,nietsmeer.Daaraantedenken dathelptme.ikbennietalleen. Y. Jevindtfeitelijkeenzekerevreugde?Eenlevensvreugde? J.L. Opiederogenblik.Datmaakthetdemoeitewaardomteleven. Achaquejoursuffit sapeine Y. Wel,ikwiljebedanken.Wezoudenhierkunnenafsluitenwant. MadameBerodes Enmagikjullienueenglaschampagneaanbieden? Commentaar: Jepsychologischeveerkracht(demogelijkheidomopnieuwrechtteveren,vannietbijde pakkenteblijvenzitten)vanjeanlouisisbevredigend.dievanzijnechtgenoteevenzeer. Zesteunto.a.ophetfeitdatzeeenkoppelvormenwaarliefdeheerst.Liefdevoordean der,liefdevoordekinderen;maarookvoordefamilieenvrienden. JeanLouiszegtdathijkatholiekis.Inzijnjeugdjarenwashijlidvankatholiekejeugdver eniging.maartijdenshetinterviewscheidthijzijnfilosofischeenreligieuzeovertuigingen vanzijnbekwaamheidomterugrechtteveren.hijmeentdatzijnreligieuzeovertuiging geenondersteuningheeftbetekendmaardathetzijnomgevingis,zijnechtgenote,zijn broersenzijnkleinkinderendiehemdieveerkrachthebbenbezorgd. Yvon IMSO 2014/4 18

19 Feestkalender2015 Zaterdag 25 april Zondag 10 mei Kippenfestijn Rotary Moederdag - I.M.S.O. Woensdag 03 juni Algemene vergadering I.M.S.O. Zaterdag 06 juni Zondag 14 juni Koud Buffet Vrijwilligers Vaderdag I.M.S.O. Zaterdag 22 augustus Motoren Kapelle o/d Bos Zondag 23 augustus Zondag 30 augustus Zaterdag 05 september Zaterdag 10 oktober Woensdag 11 november Dinsdag 08 december Maandag 14 december Fietsen met Eddy Merckx Barbecue - I.M.S.O. Uitstap patiënten - I.M.S.O. Mosselfeest - I.M.S.O. Pannenkoekenbak VZW steunt MS Kerstfeest - Rotary Bedeling Kerstmis - I.M.S.O. DEZE KALENDER KAN GEWIJZIGD WORDEN. Opgemaakt IMSO 2014/4 19

20 15 de KIPPENFESTIJN georganiseerd door Rotary Club Zaventem Beste vrienden Zaterdag 25 april is een belangrijke datum voor Rotary Club Zaventem want dan houden/organiseren wij ons 15de Kippenfestijn, dus noteer deze datum vlug in jullie drukke agenda. Gezien het grote succes zijn we ook dit jaar doorlopend open van tot uur. Je betaalt voor een lekkere halve kip met frietjes en saus 15,00 euro en 10,00 euro voor de kinderportie. Het vervangmenu is een Koninginnepasteitje. Met de opbrengst kunnen wij weer heel wat personen en organisaties een beetje gelukkiger maken en in de eerste plaats de patiënten van de MS-kliniek te Melsbroek. Verder steunen wij : Sportkampen: een organisatie voor jongeren in Steenokkerzeel, Nationale vereniging voor gehandicapten, Cocon/Machelen, De Klink in Diegem: een opvangcentrum voor personen met een handicap, De Zoekmand in Zaventem: een organisatie voor minderbedeelden ism het OCMW Zaventem, Join2bike/Pellenberg: een organisatie om revalidatie via fietsen te bespoedigen, Woon- en Zorgcentrum/Zaventem: aanpassingen van hun busje werd gesponsord, Een cultuurproject ism Zaventemse organisaties o.a. de gemeentelijke academie, En nog veel meer kleine projecten. Plaats : M.S.-kliniek, Vanheylenstraat 16 te 1820 Melsbroek, ook parking via Vereeckenstraat. Volg ons ook op facebook op https://www.facebook.com/rotaryclubzaventem Ik hoop jullie daar talrijk te mogen begroeten en uiteraard zijn familie, vrienden, kennissen, zakenrelaties,.. ook hartelijk welkom! Vriendelijke groeten. Marc Muys IMSO 2014/4 20

21 25 JAAR IMSO 2014/4 21

22 PUZZEL EN SUDOKU Puzzel Wij ontvingen 13 oplossingen waarvan 3 foute; Correcte antwoorden werden ingestuurd door :Frieda Clemens, Rita Pans, M.-L. Peetermans, Madeleine Petrus, William Van Gijsel, Rita Verbeke,Livia Verschueren Noëlla Wuytack Uit de hoed kwam : Noêlla Wuytack. Proficiat. Sudoku Er waren 12 correcte antwoorden :Brigitte Drabbe,Freddy Franckaert, Rita Pans,Marie-Louise Peetermans, Madeleine Petrus,Simone Staels,William Van Gijsel,Rita Verbeke, Paula Verhelst,Livia Verschueren,Martha Vervoort,Noêlla Wuytack. De winnares heet Simone Staels: Gefeliciteerd. IMSO 2014/4 22

23 ZweedsepuzzelN 1 IMSO 2014/4 23

24 IMSO 2014/4 24

25 IMSO 2014/4 25

26 ANNIVERSAIRES VERJAARDAGEN JANUARI - JANVIER FEBRUARI - FEVRIER PETRUSMadeleine DILBEEK SCHNEIDEREmile BRUSSEL BEULLENSWilly HERENT LEGRANDCARMONTOTH JEMAPPES LECLERQMarguerite BRUSSEL DECOSTERRACHEL STEENOKKERZEEL DEVRIESJan SCHELLE DENEYERMathieu BRULYDEPESCHE VANWILDERODEDaniel ZAVENTEM FRANCKAERTFreddy STGILLISWAAS VITALEGiovanni HALLE DEGEYTEREliane RIXENSART CARDONJacqueline KRAAINEM BERCKMANSJeannine MECHELEN Zr.M.BOONE BRUGGE DEWAEGENEERMagda WELLE CHITOURZouhir ALGER GOOVAERTSAugusta DUFFEL VANSANTVOORTM.T. WENDUINE SMETSLieve NIJLEN(Bevel) MOMMENSGermaine ELEWIJT RITSRita KAMPENHOUT CEYSSENSRoger KURINGEN VANBENEDENAndré WILLEBROEK DEROOIngrid GEMBLOUX LECLERCQ ENGHIEN VANHECKEBerlinda STNIKLAAS HEERWEGHGreta TEMSE HEYVAERTLuc RESSEGEM MATHIEULuc HEISTO/DBERG HORVATHBerlinda TEMSE VANDERSICHELChristine ASPER DEGRAEFCarine EDEGEM VERHOEVENNadine BEVERENWAAS PEETERSPatriek BRUSSEL DEWEERTIngrid HERENT KINDERMANSHilde LANDEN DELANGHECaroline MARIAKERKE COOREMAN ELEWIJT RENTEURSFrancois DEURNE(Antw) VANTHOORNancy BERLARE VANWAEYENBERGHEllly OVERMERE VANNIEUWENHOVENJ. LONDERZEEL VANDENBRANDEDaniel PUTTE VERDUYCKTJocelyne BETEKOM LELIVELDKarin RIJMENAM PIESSENS LONDERZEEL CLAEYSNicole GRIMBERGEN WILLEMInge ASSEBROEK DURETFanny BRUXELLES DEVOSPascal KONTICH POPLEMONTValerie ANDERLECHT THIENPONTNathalie MECHELEN DEVRIESKoen HERENT KAMERSAn STROMBEEKBEVER RIBUSJessy BOORTMEERBEEK IMSO 2014/4 26

27 IMSO 2014/4 27 MAART - MARS LORMANSMarieJosee NEUVILLEENCONDROZ VANDECASTEELER. JETTE STOCKXCecile MEISE HUYGENSAndré TESSENDERLOO EYCKMANSMaria BONHEIDEN MARCQGilberte VIVEGNIS DELMOITIEZElke SOIGNIES VANROOSBROECKJos PUTTE ELBENNIHilal BORGERHOUT HENSGenoveva SCHOTEN VERVOORTMartha SCHOTEN RAEMDONCKGerard WAASMUNSTER WERELDSA. DENDERHOUTEM OLBRECHTSJozef BEIGEM VERBEKERita HOEVENEN VERBRUGGENDiane NIEUWPOORT BOMBEKERita SCHELDEWINDEKE PEETERMANSML VEERLELAAKDAL VANDAMMarie LINKEBEEK LUYCKFASSEELFrancine VILVOORDE LEMMENSALEXjos HECHTELEKSEL VERNIMMENMarieChristine HAMME NOENSGilbert STNIKLAAS LAMARQUEBern SOIGNIES VANDERFAEILLIEPaul TERVUREN VERSTRAETENDirk BRASSCHAAT ZEGERSMaria HEISTOPDENBERG HERMANSMarleen LOKEREN MILLANRUIZAnna VILVOORDE SMEKENSWerner WOMMELGEM VERSCHUERENLivia DEURNE VANDEVONDELIRA ANTWERPEN(Hoboken) KALOGEROPOULOSRosa ANDERLECHT LESSIRDominique WOLUWESAINTLAMBERT FRIEDRICHJoyce TERVUREN VANASSCHEMaaike HERENT

28 NouvellesduConseild Administration LevoyageannuelversleSud Depuisdenombreusesannées,l I.M.S.O.organisaitunvoyageannuelversle sud,leplussouventàlafindeseptembreouaudébutd octobre,afind éviterles grosseschaleursetd avoirdemeilleuresconditionspécuniaires.en2000,cefut leprésidentpolvanvlasselaerquiorganisacevoyagepourlapremièrefois.en cetempslàladestinationétaitl Espagne,leplussouvent,etlevoyagesefaisait enbus,cequipermettaitdesvisiteslocales.laparticipationdespatientsn était possibleques ilsétaientaccompagnésd unpartenairequipouvaitlesassister pourlessoinséventuelsetlesdéplacements. Àpartirde2000,cettefonctionfutrepriseparChristeletBrigitte,puisparBrigit teseule.levoyageeutalorslaturquiepourdestination,parfoisl Espagne,mais paravionàchaquefois. Cesdernièresannéesl organisationduvoyageestdevenueplusdifficileàcause del «overbooking»desagencesdevoyage,cequifaitquesurplaceiln yapas assezdechambresdisponibles.ilyaaussiqueledegrédedépendancedes patientsparticipantsestdevenuprogressivementpluslourd,cequidemande plusd effortsdespartenairesetdesaccompagnateurs.àcelaestvenus ajouter quebrigitteestpartieàlapensionetqu ellenesesentpluscapabledeprendrela responsabilitédel organisationd untelvoyage. Pourcetteraison,leconseildegestiondel I.M.S.O.adécidédesupprimerce voyageetdeleremplacerparunedeuxièmeexcursiond unjourannuellement. Leséjouràlamer,àl hôtelsandeshoved Nellyarapportéquesafréquentationdel appartement,en2014,avaitfortement augmentéparrapportàprécédemment.parrapportà2013,ilyavait9w.e.de plusd occupation. Àquelquesremarquesprèslesutilisateursserépartissaientdecontentsàtrès contents.àlademandedenotresponsor,lerotaryclubdezaventhem,christel etnellyvontluifournirunrapportdansunedeleursprochainesréunions. IMSO 2014/4 28

29 CannabisàdesfinsthérapeutiquesetSEP Cettematièreafaitl objetdanslapressedeplusieursmisesaupoint.lesmé decinsdenotrecentreontpréciséleuropinionetprisposition. Elleaétéformuléele sur«Alaloupe Infolettreduwebsitedu CentreNationaldeMelsbroek(CNSEP),www.mscenter.be: «Nosmédecinssouhaitentpréciserquelquespointsausujetdesmessages concernantlesinformationsparuesdanslesmédiasfin2014,concernantle traitementthérapeutiquedelasepparlecannabis. Avanttoutechose,ilconvientdenoterqu ils agituniquementd uneproposi tionvisantàélaborerunarrêtéroyalquipermettraitlaventedecannabisà desfinsthérapeutiquesdanslespharmacies.celasignifiequel usagelégal n estpasencoreàl ordredujourencemoment.l élémentprincipalducan nabis,notammentlescannabinoïdes,seraitdisponiblesouslaformed unva porisateur.dansquelquesautrespays,untelvaporisateurestdéjàdisponi ble. Noussouhaitonspréciserquelecannabisnepeutréduirequ unseuldes nombreuxsymptômespossiblesdelasep,àsavoirlaspasticitédouloureuse. Saplacedansletraitementdelaspasticité,causéeparlaSEP,resteà déterminer. Selonnotreexpérience,lesautrespossibilitésdetraitement,commelakinési thérapie,lamédicationcontrelaspasticitéetlesapplicationsdeglace,conti nuerontàgarderuneplaceimportantedansletraitementdelaspasticité. Lescannabinoïdessousformedevaporisateur,ontégalementdeseffetsse condaires.enoutre,l éventuellefuturedisponibilitéduproduitn estpasune raisonpourchangerlapolitiqueconcernantlecannabisauseinducnsep. Nousrépétonsquel emploiducannabisauneinfluencenégativesurlasanté engénéraleetl évolutiondelasep.voilàpourquoilesdrogues,telquele cannabis,restentstrictementinterditsaucnsep». IMSO 2014/4 29

30 Journée mondiale de la MS Journée mondiale «MS Day» cette année a lieu le mercredi 27 mai et sera organisée au Parc Walibi de Wavre. Vivre avec la SP implique toutes sortes de défis. Dans la perspective de la Journée mondiale de MS 2015, nous voulons célébrer de quelles façons les gens du monde entier ont levé les barrières provoquées par la SP. Nous allons demander aux participants de nous renseigner sur les personnes, les moyens et les organisations qui ont permis de briser ces barrières et d améliorer leur qualité de vie. Les participants pourront partager un message avec la personne ou l'organisation qu'ils désirent sur les médias sociaux, par courriel ou par la poste. Ensemble, nous allons générer des milliers de messages qui créeront des réseaux de soutien. Le but est de sensibiliser et d inspirer des actions, contre ces obstacles handicapant la vie avec la SP. Il y a beaucoup de manières de vous impliquer dans la Journée mondiale de la SEP de cette année: vous inscrire à notre bulletin électronique gratuit ou directement au site de la Ligue Belge de la Scléose en Plaques : nous suivre sur Twitter, communiquer sur Facebook, organiser un événement et le diffuser au monde utiliser le logo de la Journée Mondiale de la SEP ou d'autres documents de la campagne sur votre site web, le pare-brise de la voiture, votre compte Twitter ou un panneau d'affichage. IMSO participera également à cette manifestation. IMSO 2014/4 30

31 InterviewdeMonsieurJeanLouisBERODES,du6février2015. Jel airencontréquimarchaitdanslescouloirsducentre,aumoisdedécembre dernier,alorsquej étaisàlacliniquepourladistributiondescadeauxdenoëlde l I.M.S.O.Ilmeracontaqu ilvenaitenhospitalisationpourlapremièrefoispour unséjourdequelquessemaines,pourlaréadaptation. Rapidement,uncourantdesympathiepassaentrenous,sibienqu aprèsunseul quartd heuredeconversation,nousnousquittâmesamis.letempsnefaitrienà l affaire.celapsdetemps,sicourtfutil,suffitcependantpourquejeanlouis meconfiespontanémentsespréoccupationslesplusintimes,sursamaladieet sonvécufamilial.jelelaissais épancher,tantjeressentaisqu ilenéprouvait l impérieuxbesoinetproposaiqu ils exprimedansuneinterviewquiparaîtrait danslarevuedel IMSO.Ilacceptaavecenthousiasme.Elleeulieuchezlui,à Koekelberg,enprésencedesonépouse. Yvon Parlonsd aborddetonéducation,detonmilieufamilial. J.L. Monpapaétaitagentdepoliceetmamamanétaitcoiffeuse.Noussommes partisaucongobelge(ndlr:j.l.avait6ans)pendanttroisans,de1957à 1960.Puisj aicontinuémesétudesprimaires,puisj aifaitdesétudesmoyennes etonm adirigéversl enseignementtechnique.j étaisplutôt«pratique»,j avais envied unmétiermanuel.là,j aiterminélesétudes,en1968.alors,suiteàça, j aicommencéàapprendrelemétierdecarrossierchezopelmabille,chaussée degand,lamêmeannéeoùj étaisapprenti.j aifaitmonservicemilitaireen 1969.En1970,j aireprislacarrosserieetjesuisdevenuouvriertôlieràpartirdes années70.puis,en1974,jesuisentréàlacommunautéeuropéennecomme huissiermessager,aveclestatutd agentlocal.ensuite,j aicommencéàsuivreà nouveaudescourspourmeperfectionneretj aipasséunexamen.j aiéténom méfonctionnaireetpuis,suiteàcela,j aicontinuéàgravirleséchelons. Y. Celan avaitplusrienàvoiraveclamécanique!qu estcequit afaitchan gerdemétier? J.L. Àcausedupremierchocpétrolier,en1973,monpapam avaitdit: «Écoute,çavatrèsmaldanslesgarages».Commeiltravaillaitdanslequar tierdesinstitutionseuropéennes,ilavaitentendudirequ onrecrutaitdesagents locauxetalorsjesuisallé,sansentrainparcequej aimaisbienmonmétierde carrosserie.jemesuisaccrochéet,finalement,j aiterminémacarrièrelà.j ai IMSO 2014/4 31

32 travaillé35ansàlacommission,unecarrièrecomplète,quoi.j aifaitplusieurs postes,toujoursdansl administration,toujoursdanslesressourceshumaines, jusqu àfin2009. Y. Revenonsenarrière:vousavezétérapidementencouple? J.L. Oui,déjààlaCommunautéEuropéenne.Ons estconnuen1971etons est mariéen1972.çafaitmaintenant43ans. Y. Vousavezeudesenfants?Onaadoptédeuxenfants,provenantdel Inde. OnaétélestrouverdanslesbidonvillesdeBombay.Lafilleestvenuecheznous àdeuxansetdemietsonpetitfrèretroisansaprès. Y. Vousavezencoreeud autresenfants? J.L. Malheureusementnon. Y. Tum avaisditquetonfils. J.L. Ils estsuicidé,ilamisfinàsesjoursparcequ ilsouffraitdeschizophrénie. Pendanthuitansetdemi,onagaléré.(NDLR:Grandmomentd émotion) Y. Tuavaisbeaucoupd amis? J.L. Oui,beaucoupdeconnaissancesetbeaucoupd amisetmonépouseaussi. J aiunamidelonguedate,avecquij aiétéàl écoleprimaireen1964. Y. Et,unefoisatteintdeSEP,quelleétaittaplaceauprèsdetesamis? J.L. J aigardélaplupart.onresteencontact. Y. Moinsqu avant? J.L. Jemedéplacemoinsqu avant. Y.Reprenonslapériodedetonenfance:comments estellepassée? J.L. Toutàfaitnormalement.Moi,jen aijamaisentendumesparentssedispu ter. Y. Cetteviequetuavaisàcemomentlà,estcequetuconsidéraisquec étaitla «vraievie»etquemaintenantquetuaslasep,cen estplusla«vraievie»? J.L. Non,çapas.Bon,ilyaeuunavantetilyaunaprès.Jeveuxdirequeje mesuisadapté.quandleprofesseurd Érasmem adit,aprèsm avoirdonnémon diagnostic:«revenezdans6mois»,vousdigérezcela.cequej aifait.j aifait IMSO 2014/4 32

33 uneréflexionsurmoimême.jepensesurtoutàcequej aieuetquedesplus jeunesn ontpasl occasiond avoir.finalement,jel aieueàpeuprèsàcinquante ans,lasep.ilyadesjeunesde25ansquil ont.là,sijefaislacomparaison et j aieuunejeunessetrèsheureuse. Y. Vivrepoursoimêmeavaitildusensàtesyeux? J.L. Non,moijevispourlesautres.Cequimemanqueaussiénormément,c est quejenepeuxplusaiderlesautres.jepeuxaider,mais plusphysiquement. Y. Tonniveaud estimedetoimême?bonneconfianceentoi? J.L. Oui! Y. Quellessonttesconvictionsphilosophiquesetreligieuses? J.L. Moi,jesuiscatholique,j aiétébaptisé,j aifaitmescommunions,ons est mariéàl église. Y. Tuescroyant? J.L. Oui,maisnonpratiquant.(NDLR:ilestressortiplustarddesproposdeJ. L.qu ilcroyaitenjésusplusqu endieuetqu ilétaitsurtoutgrandadmirateuret granddiscipledejésusetdesonenseignement.) Y. Tuastoujourseubeaucoupd amis? J.L. Oui,j enaiunaucentre,aveclequeljesuistoujoursencorrespondance: c estmonsieurluclemaire.(ndlr:jeleconnaistrèsbienetj aifélicitéj.l. poursonchoix.) Y. Quelétaittonrapportàl argentetauxbiensmatériels? J.L. Jedirais:commelaplupartdesgens:sij avaisbesoind unvélo,d une voiturejemel achetais.l argentn étaitsûrementpasunbut,non. Y. Qu estcequit attachaitàlavie,fondamentalement? J.L. Lafamille,lesenfants,lesamis.Etc estencorelecasactuellement,jedois dire. Y. Estcequetuavaisdegrandsbesoinsmatériels? J.L. Non,ilyadesgensquin enontjamaisassez.non,nous,notrebut,c était lesenfants. IMSO 2014/4 33

34 Y. Àquoiutilisaistutonargentprincipalement? J.L. Pourlesloisirs,lesvacances,nousaimonsbienalleraurestaurant.Onaime bienaidernosproches,nosenfants,mêmecertainespersonnesdelafamillequi sontendifficulté.onauraitpuêtreplusriche,peutêtremêmeavoirunemaison enplus,maistoutçanousimportaitpeu.c étaitsurtoutvoirlesouriredes autres,pouvoiraider.monépouse,c estpareil. Y.Tuavaisbeaucoupdepossibilitésdeloisirs,detemps? J.L. Oui.Donc,nosloisirssepassaientenvoyages,activitésculturelles,piscine. Y. Donc,dusport!Lesportprenaitunegrandeplace? J.L. Oui.Quandj étaisàl écoleprimaire,jefaisaisbeaucoupdenatation.j étais dansunclubàanderlecht,auceria.j aifaitunpeudefootball,j étaisdansun clubdepingpong.jejouaisunpeuautennis,aufootballdetable,auxcartes, auxjeuxdesociétés. Y. Tuastoujourseuunebonneestimedetoimême,unebonneconfianceen toi?j.l. Oui. Y. Parlonsdelapériodeautourdetondiagnostic.Quandtamaladieatelle commencé? J.L. Jedoisdire,auniveaudelamarche,lespremierssymptômesontcommen céen2004(à53ans).jemesuisrenducomptequejenesavaisplusfairedesi longstrajets.après,c étaitleproblèmedelastationdebout.allerenmétropar exemple.après,j aireprismavoiturepourallertravailler.puis,ons estrendu comptequej avaisdifficileàfairelejardin,jedevaisfairedespauses,m asseoir. Etquandnotrefilsafaitsapremièretentativedesuicide,en2005,onacruque c étaitunpeuçaquiapportaitunexcèsdefatigue,queçam avaitdonnéunchoc. Etalors,onn arienfaitjusqu en2008.après,j aipassétouslesexamens,une IRMetsuiteàçaj aiétéhospitalisépendantplusieursjours.ilsontfaitune ponctionlombaire,etc.etlàiladit:«vousavezunescléroseenplaquespri maireprogressive».là,j aicommencéàtravailleràmitemps,pendantunanet demi.j allaislematinetjedevaism occuperdegroupesd agriculteur.c était assezfatigant.onm aremisdansunbureauetjegéraistoutsurordinateur. Y. Ahoui!Donc,ças estassezbienpassésurleplanprofessionnel,ons est bienoccupédetoi,onatenucomptedecequit arrivait. IMSO 2014/4 34

35 J.L. Absolument.Letravailàmitempspourraisonmédicaleestlimitéàsix mois,ilsontfaituneexception,j aipulefairependant18mois.lemédecindu travailm adit:«vousêtespresqu enfindecarrièreàquelquesmoisprès».je pensaisarrêterà60ans,j aiarrêtéà58ansetdemi.jel aibienpris. Y. Tuasputeprépareràlapension? J.L. Jemesuispréparépendantunanetdemi. Y. Tuasanticipé:après,qu estcequejevaisfaire? J.L. Exactement.Oui,etcequ ilyaaussi,c estquemonépousem adit,dèsque lediagnosticaétéconnu:«onvavendrelamaison.onvaacheterunapparte ment».elleatrèsbienfait.parcequemoijen étaispasenclinàlefaire.jeme débrouillais,jepouvaisencoremonterlesescaliers.non,elleabienfait. Y. Taplacedanslafamillen apaschangéaveclamaladie? J.L. Non,pasdutout.Ongardeungroupe,autravail.Onproposedevenirme chercherenvoiture.ilyaensuisseunlaboquiatrouvéquelquechosedetrès avancé.onl amissurlemarché.c estunmédicamentquirecréelamyéline. Y. Auniveaudel identitéetdelapersonnalité:qu estcequitemaintenait attachéàlavieencettepériodedediagnostic? J.L. Jesuisrestéoptimiste. Y. Lespertesfonctionnellesnet ontpastropperturbé? J.L. Non,j aipesélepouretlecontre,j aidit:ilyadeschosesquejenepourrai plusfaire.jevaisessayerdecompenserpard autreschoses. Y. Qu estcequit aaidéàrebondir? J.L. Monentourage,monépouse,mesfrères,nousavonsdespetitsenfants. Y. Vosamisn ontpaschangéd attitudeenverstoi? J.L. Non. Y. Tun asjamaiseul attitudededire:maintenant,jevaisvivrepourmoi? J.L. Non. Y. Dupointdevuedesadaptationsdudomicile,tun enasjamaiseubesoin? IMSO 2014/4 35

36 J.L. Danslasalledebainsonvamettreun«aqualift»électrique.Jevaisavoir uneorthèsepourmonpieddroit,unreleveurdupied. Y. Auniveaudesloisirs? J.L. Jelis,jevaissurmonPC,uneheureparjour.Jevaissurinternet.J aiskype. Aupointdevuetravail,jen étaispastropfatiguéparcequejepouvaistravailler surordinateur.jem occupaisduprixdeslégumes,delaviande.s ilfallait,je prenaisdesinterprètes. Y. Tuasrencontrédelacompréhensiondanslafamille,danstoncouple? MadameBerodes J aieudumal:lamaladiedemonmari,lamortdemonfils. J.L. Surdeuxansdetemps,onaperdulesparentsdemafemmeetmespa rents.onadesressourcesqu onnesoupçonnepas.onvachercherdansses entrailles,pourcontinueràrebondir,àvivrepourlesautres.parceque,moi,je vispourlesautres.j aimebienmavie,mais. Y. Tudonnestavie! J.L. Oui,c estça!unsouriredemonépousequandelleestcontente.quand ellefaitunbonpetitrepas,jeleluidis. Y. Cesontceschosesquisont. J.L. Quiparaissentanodinespourcertainsmais. Y. maisc esttrèsimportantlà. J.L.(NDLR:Ici,J.L.revientsursonfilsmort) Onl aeupendant29ans.ilétait toujoursàcôtédemoi.ilétaitsouventcheznous.deparsamaladie,ilétaitfort affaibli,trèsvulnérableet excusezmoi (Silence). Y. L estimedetoin apaschangédufaitquetuesdiminuéphysiquement? J.L. Non,jedis,parrapportauxjeunesetauxgensquej aivu(àmelsbroek), celam aencorerenforcé:jenepeuxpasmeplaindre.moijepeuxencorefaire deschoses.tandisqu ilyenaquisontlàdansleurfauteuilroulantélectrique, quicommandenttoutavecleurmenton,quisontdépendantspourtout,absolu menttout,etquiontencorecetteforcedevouloirvivre!parcequ ilspeuvent demander,quandilsveulent,d abrégerleurvie.c estdanslaloimaintenant, donc.physiquement,ilsn ontplusrien,maislecerveaufonctionnetrèsbien. Etcesourire. IMSO 2014/4 36

37 Y. Estcequetupensesquetesconvictionsreligieuses,croyancessontun soutien?j.l. Non. Y. C estquelquechosed àcôté? J.L. Oui.J aifaitlapartdeschosesenmedisant:jesuisd accord,lebondieu onycroitettoutça,maisquandonvoitcequ ilyenaquifontetquipassentà traverstout alorsjerelativise.jesuistrèscroyantmais.moijecroisplusen Jésusqu endieu.jésus,c estquelqu un. Y. Oui,tues«Jésuiste»tuescommeChristianDeDuve c estparceque Jésusaexpliquécommentondevaitvivreensemble?Levivreensemble,onen parlaitdéjà! J.L. Onneparleplusdecelamaintenant,mais imaginonsquejesuisen Syrie:jen aiplusdemaison,jen aiplusdesoins,jen aiplusrien.celam aide psychologiquement.iln yapasquemoi. Y. Voustrouvez,danslefond,unecertainejoie?Unejoiedevivre? J.L. Devivrechaquemoment.Celavautlapeined êtrevécu.achaquejour suffitsapeine. Y. Ehbien,jeteremercie.Onvapeutêtreclôturerlàparcequ onpourrait. MadameBerodes Maintenant,jevousmetsunpetitverredechampagne? Commentaires: Larésilience(lefaitd avoirbienrebondi)dejeanlouisestàunbonniveau. Celledesonépouseégalement.Ellesefonde,entreautre,surlefaitfrappant qu ilsformentuncoupleoùl amourrègneenroi.l amourl unpourl autre, l amourpourleursenfants;aussipourtoutelafamilleetlesamis. JeanLouisseditcatholique.Jeune,ilestallédansunmouvementdejeunesse catholique.mais,aumomentdel interview,ilsemblait,danscertainsdeses propos,plushumanistequereligieux. Ilséparesesconvictionsphilosophiquesetreligieusesdesacapacitéde résilience.ellesnejouentpas,ditil. Entrenous,uneamitiéestnée. Yvon IMSO 2014/4 37

38 IMSO 2014/4 38

39 Hi everyone, I m Cenkal. I m not good at talking myself and you can see that my English isn t good but I ll try. I came from Istanbul, Turkey. Some of you already know I ve been working as a volunteer in MS Center. By the way, I know very difficult to pronounce my name for you. You can call me as you wish. about If you let me I want to introduce my city a bit. Istanbul is very important place in the world. The city is spread over an area of km km long and 50 km wide. Istanbul became the biggest and the most crowded city of Europe. Because, it s location between Asia and Europe, the city always had a great geopolitical importance. The city population is 15 millions. Around 2 millions tourists visit Istanbul every year. They are see the historical and natural beauties of the city. The city has a lots of historical mosque, church and museums of Turkey. Maybe one day you'll also visit this beautiful city and if you visit, you should absolutely see Dolmabahçe Palace Museum, Grand Bazaar, Topkap Palace, Galata Tower, Leandros Tower, Hagia Sofia, Blue Mosque, Taksim Square, Çamlca Hill and Prince Islands Last year I graduated Econometrics from Karadeniz Technical University. I want to make master degree next year. By the way, Econometrics is the application of mathematics, statistical methods, and computer science, to economic data and is described as the branch of economics that aims to give empirical content to economic relations. IMSO 2014/4 39

40 While studying at university, I heard about Youth Exchange and Voluntary Service from a friend of mine. The European Voluntary Service (EVS) is a program of the European Union that has the aim to achieve cultural exchange between different countries due to young people that are working and living in different projects. For example are dealing with the environment, with patient people, with children or with art projects etc. The European Voluntary Service (EVS) by means of it helps to develop solidarity, mutual understanding, patience and tolerance among young people, thus contributing to strengthening social cohesion in the European Union and to promoting young people s active citizenship. Then I ve decided this program is suitable to me. After a difficult process, I came to Belgium on the 8th of January. I ve been here for almost three weeks. Since my first day until today in Belgium I learned so much and I ll continue to learn. I m so happy for to be with you. People are so nice, helpful, friendly, behaving polite. Me and my colleague Sarah, we are both working in cybercafé and cafeteria. Basically our work contains of two important parts; to provide help at the use of the computer in the cybercafé and to work at some evenings of the week in the cafeteria to serve drinks. I m helping patients to surf on internet, playing rummikub, reading news which they want and writing to their friends or parents and I m also taking a time table about patient s using computer time for statistics. I have only one problem. It is language problem. I have to improve my English skills and learn to Dutch. I ll handle it. I just need more time. My language course will begin next week. So I'm very excited. Greetings, Cenkal KARAKAYA IMSO 2014/4 40

Understanding and being understood begins with speaking Dutch

Understanding and being understood begins with speaking Dutch Understanding and being understood begins with speaking Dutch Begrijpen en begrepen worden begint met het spreken van de Nederlandse taal The Dutch language links us all Wat leest u in deze folder? 1.

Nadere informatie

dv d sign is following a new direction

dv d sign is following a new direction tavola d sign dv d sign is following a new direction dv d sign produce objects for interior decoration in your home, which are sold across the World! The goal of our design is always to combine the best

Nadere informatie

Houdt u er alstublieft rekening mee dat het 5 werkdagen kan duren voordat uw taalniveau beoordeeld is.

Houdt u er alstublieft rekening mee dat het 5 werkdagen kan duren voordat uw taalniveau beoordeeld is. - Instructie Deze toets heeft als doel uw taalniveau te bepalen. Om een realistisch beeld te krijgen van uw niveau,vragen we u niet langer dan één uur te besteden aan de toets. De toets bestaat uit twee

Nadere informatie

Listen. Twenty One Pilots Niveau 3a Song 4 Lesson B Worksheet. a Luister naar wat Leo, Tina en Martin vertellen. Omcirkel het juiste antwoord.

Listen. Twenty One Pilots Niveau 3a Song 4 Lesson B Worksheet. a Luister naar wat Leo, Tina en Martin vertellen. Omcirkel het juiste antwoord. 1 Listen a Luister naar wat Leo, Tina en Martin vertellen. Omcirkel het juiste antwoord. 1 Leo is a kid / a teenager / a grown-up. 2 Tina is a kid / a teenager / a grown-up. 3 Martin is a kid / a teenager

Nadere informatie

De grondbeginselen der Nederlandsche spelling / Regeling der spelling voor het woordenboek der Nederlandsche taal (Dutch Edition)

De grondbeginselen der Nederlandsche spelling / Regeling der spelling voor het woordenboek der Nederlandsche taal (Dutch Edition) De grondbeginselen der Nederlandsche spelling / Regeling der spelling voor het woordenboek der Nederlandsche taal (Dutch Edition) L. A. te Winkel Click here if your download doesn"t start automatically

Nadere informatie

RECEPTEERKUNDE: PRODUCTZORG EN BEREIDING VAN GENEESMIDDELEN (DUTCH EDITION) FROM BOHN STAFLEU VAN LOGHUM

RECEPTEERKUNDE: PRODUCTZORG EN BEREIDING VAN GENEESMIDDELEN (DUTCH EDITION) FROM BOHN STAFLEU VAN LOGHUM Read Online and Download Ebook RECEPTEERKUNDE: PRODUCTZORG EN BEREIDING VAN GENEESMIDDELEN (DUTCH EDITION) FROM BOHN STAFLEU VAN LOGHUM DOWNLOAD EBOOK : RECEPTEERKUNDE: PRODUCTZORG EN BEREIDING VAN STAFLEU

Nadere informatie

VOORZETSELS. EXERCISE 1 Bestudeer de bovenstaande voorzetsels en zinnen goed!

VOORZETSELS. EXERCISE 1 Bestudeer de bovenstaande voorzetsels en zinnen goed! ENGLISH, WE WILL DO BETTER! LESSON EIGHT VOORZETSELS at three o'clock = om drie uur around three o'clock = rond drie uur by three o'clock = tegen drie uur before Saturday = voor zaterdag for a week = voor

Nadere informatie

Main language Dit is de basiswoordenschat. Deze woorden moeten de leerlingen zowel passief als actief kennen.

Main language Dit is de basiswoordenschat. Deze woorden moeten de leerlingen zowel passief als actief kennen. Lesbrief Les 2.1: My family Main language Dit is de basiswoordenschat. Deze woorden moeten de leerlingen zowel passief als actief kennen. Nouns: brother, sister, cousin, mother, father, aunt, uncle, grandmother,

Nadere informatie

Comics FILE 4 COMICS BK 2

Comics FILE 4 COMICS BK 2 Comics FILE 4 COMICS BK 2 The funny characters in comic books or animation films can put smiles on people s faces all over the world. Wouldn t it be great to create your own funny character that will give

Nadere informatie

Bijlage 2: Informatie met betrekking tot goede praktijkvoorbeelden in Londen, het Verenigd Koninkrijk en Queensland

Bijlage 2: Informatie met betrekking tot goede praktijkvoorbeelden in Londen, het Verenigd Koninkrijk en Queensland Bijlage 2: Informatie met betrekking tot goede praktijkvoorbeelden in Londen, het Verenigd Koninkrijk en Queensland 1. Londen In Londen kunnen gebruikers van een scootmobiel contact opnemen met een dienst

Nadere informatie

Dutch survival kit. Vragen hoe het gaat en reactie Asking how it s going and reaction. Met elkaar kennismaken Getting to know each other

Dutch survival kit. Vragen hoe het gaat en reactie Asking how it s going and reaction. Met elkaar kennismaken Getting to know each other Dutch survival kit This Dutch survival kit contains phrases that can be helpful when living and working in the Netherlands. There is an overview of useful sentences and phrases in Dutch with an English

Nadere informatie

Davide's Crown Caps Forum

Davide's Crown Caps Forum pagina 1 van 6 Davide's Crown Caps Forum A Forum for Crown Cap Collectors Zoeken Uitgebreid zoeken Zoeken Forumindex Crown Caps Unknown Caps Lettergrootte veranderen vriend Afdrukweergave Gebruikerspaneel

Nadere informatie

20 twenty. test. This is a list of things that you can find in a house. Circle the things that you can find in the tree house in the text.

20 twenty. test. This is a list of things that you can find in a house. Circle the things that you can find in the tree house in the text. 9006625806_boek.indd 1 31/08/16 15:26 1 6 test This is a list of things that you can find in a house. Circle the things that you can find in the tree house in the text. living room kitchen bedroom toilet

Nadere informatie

Writing 1 WRITING 1 PART D BK 3

Writing 1 WRITING 1 PART D BK 3 Writing 1 WRITING 1 PART D BK 3 Isn t it incredible? After only two years of learning English you can write your own English WhatsApp messages, tweets and emails. You can also post some lines on an international

Nadere informatie

ANGSTSTOORNISSEN EN HYPOCHONDRIE: DIAGNOSTIEK EN BEHANDELING (DUTCH EDITION) FROM BOHN STAFLEU VAN LOGHUM

ANGSTSTOORNISSEN EN HYPOCHONDRIE: DIAGNOSTIEK EN BEHANDELING (DUTCH EDITION) FROM BOHN STAFLEU VAN LOGHUM Read Online and Download Ebook ANGSTSTOORNISSEN EN HYPOCHONDRIE: DIAGNOSTIEK EN BEHANDELING (DUTCH EDITION) FROM BOHN STAFLEU VAN LOGHUM DOWNLOAD EBOOK : ANGSTSTOORNISSEN EN HYPOCHONDRIE: DIAGNOSTIEK STAFLEU

Nadere informatie

1. In welk deel van de wereld ligt Nederland? 2. Wat betekent Nederland?

1. In welk deel van de wereld ligt Nederland? 2. Wat betekent Nederland? First part of the Inburgering examination - the KNS-test Of course, the questions in this exam you will hear in Dutch and you have to answer in Dutch. Solutions and English version on last page 1. In welk

Nadere informatie

Vergaderen in het Engels

Vergaderen in het Engels Vergaderen in het Engels In dit artikel beschrijven we verschillende situaties die zich kunnen voordoen tijdens een business meeting. Na het doorlopen van deze zinnen zal je genoeg kennis hebben om je

Nadere informatie

elke hap telt! 11 mei 2012 doe mee! participe! Chaque bouchée compte! 11 mai 2012 World Fair Trade Day

elke hap telt! 11 mei 2012 doe mee! participe! Chaque bouchée compte! 11 mai 2012 World Fair Trade Day elke hap telt! 11 mei 2012 doe mee! participe! Chaque bouchée compte! 11 mai 2012 World Fair Trade Day doe mee!! Zet op vrijdag 11 mei, op de vooravond van de World Fair Trade Day, eerlijke handel flink

Nadere informatie

THE LANGUAGE SURVIVAL GUIDE

THE LANGUAGE SURVIVAL GUIDE DUTCH THE LANGUAGE SURVIVAL GUIDE 4 0 0 W O R D S T O G E T S T A R T E D I N A N Y L A N G U A G E BY THE FOREIGN LANGUAGE COLLECTIVE Verbs Werkwoorden To be zijn I ik ben You jij bent He/She/It hij/zij/het

Nadere informatie

1. will + hele werkwoord (Future Simple) 2. shall + hele werkwoord 3. to be (am/is/are) going to + hele werkwoord

1. will + hele werkwoord (Future Simple) 2. shall + hele werkwoord 3. to be (am/is/are) going to + hele werkwoord FUTURE TENSE ( TOEKOMENDE TIJD ) Hoe? 1. will + hele werkwoord (Future Simple) 2. shall + hele werkwoord 3. to be (am/is/are) going to + hele werkwoord Wanneer? Ad 1. Als iets in de toekomst zal gebeuren

Nadere informatie

Een vrouw, een kind en azijn (Dutch Edition)

Een vrouw, een kind en azijn (Dutch Edition) Een vrouw, een kind en azijn (Dutch Edition) D.J. Peek Click here if your download doesn"t start automatically Een vrouw, een kind en azijn (Dutch Edition) D.J. Peek Een vrouw, een kind en azijn (Dutch

Nadere informatie

Gebundelde krachten vinden werk. Ensemble, trouvons un emploi Together for a job

Gebundelde krachten vinden werk. Ensemble, trouvons un emploi Together for a job Gebundelde krachten vinden werk Ensemble, trouvons un emploi Together for a job WERK IN ZICHT Vragen rond opleiding en werk in Brussel? Werk In Zicht brengt werkzoekenden in contact met de juiste diensten

Nadere informatie

Empowerment project. Driejarig project van Rotaryclub Rhenen-Veenendaal

Empowerment project. Driejarig project van Rotaryclub Rhenen-Veenendaal Empowerment project Awasi Kenya Driejarig project van Rotaryclub Rhenen-Veenendaal Empowerment*van* kinderen*in*kenia De#afgelopen#drie#jaren# hebben#we#met#steun#van#de# Rotaryclub##Rhenen: Veenendaal#een#

Nadere informatie

Grammatica uitleg voor de toets van Hoofdstuk 1

Grammatica uitleg voor de toets van Hoofdstuk 1 Grammatica uitleg voor de toets van Hoofdstuk 1 Vraagzinnen: Je kunt in het Engels vraagzinnen maken door vaak het werkwoord vooraan de zin te zetten. Bijv. She is nice. Bijv. I am late. Bijv. They are

Nadere informatie

NUCHTER, EEN HELDERE KIJK EN NO-NONSENSE

NUCHTER, EEN HELDERE KIJK EN NO-NONSENSE NUCHTER, EEN HELDERE KIJK EN NO-NONSENSE NATUURLIJK SAMEN NATURALLY DUTCH. Koolhaas Natuurlijk is a typically Dutch company: Sober, with a clear vision and no-nonsense. That s what our customers may expect

Nadere informatie

Nieuwsbrief december 2016

Nieuwsbrief december 2016 Nieuwsbrief december 2016 Jong geleerd, oud gedaan Leuk om een verrassing te krijgen zo vlak voor Sinterklaas. Wij hadden Putu Ari en Komang gevraagd om een stukje te schrijven voor de nieuwsbrief over

Nadere informatie

Ius Commune Training Programme 2015-2016 Amsterdam Masterclass 16 June 2016

Ius Commune Training Programme 2015-2016 Amsterdam Masterclass 16 June 2016 www.iuscommune.eu Dear Ius Commune PhD researchers, You are kindly invited to attend the Ius Commune Amsterdam Masterclass for PhD researchers, which will take place on Thursday 16 June 2016. During this

Nadere informatie

Contextanalyse. Patrick v/d Vlist

Contextanalyse. Patrick v/d Vlist Contextanalyse Patrick v/d Vlist Contextanalyse Patrick v/d Vlist Krimpen ad IJsel 10-01-2016 Verdoold Installatiebedrijf Voorwoord Ik heb dit rapport geschreven naar aanleiding van een communicatieopdracht

Nadere informatie

News: Tours this season!

News: Tours this season! 1 Do you remember? Lees de zinnen en vul de juiste woorden in. Kies uit: like listen presenter too loud great show number next crowd singer. Let op: je houdt twee woorden over. Welcome back to the best

Nadere informatie

Win a meet and greet with Adam Young from the band Owl City!

Win a meet and greet with Adam Young from the band Owl City! 1 Meet and greet read Lees de tekst. Wat is de prijs die je kunt winnen? early too late on time vroeg te laat op tijd Win a meet and greet with Adam Young from the band Owl City! Do you have a special

Nadere informatie

Appendix A: List of variables with corresponding questionnaire items (in English) used in chapter 2

Appendix A: List of variables with corresponding questionnaire items (in English) used in chapter 2 167 Appendix A: List of variables with corresponding questionnaire items (in English) used in chapter 2 Task clarity 1. I understand exactly what the task is 2. I understand exactly what is required of

Nadere informatie

Mondeling tentamen Havo - ERK niveau B1 / B1 +

Mondeling tentamen Havo - ERK niveau B1 / B1 + Mondeling tentamen Havo - ERK niveau B / B + Het mondeling voor Engels Havo duurt 5 minuten en bestaat uit een gesprek met je docent waarin de volgende onderdelen aan de orde komen: *Je moet een stukje

Nadere informatie

Engels op Niveau A2 Workshops Woordkennis 1

Engels op Niveau A2 Workshops Woordkennis 1 A2 Workshops Woordkennis 1 A2 Workshops Woordkennis 1 A2 Woordkennis 1 Bestuderen Hoe leer je 2000 woorden? Als je een nieuwe taal wilt spreken en schrijven, heb je vooral veel nieuwe woorden nodig. Je

Nadere informatie

Het Effect van Verschil in Sociale Invloed van Ouders en Vrienden op het Alcoholgebruik van Adolescenten.

Het Effect van Verschil in Sociale Invloed van Ouders en Vrienden op het Alcoholgebruik van Adolescenten. Het Effect van Verschil in Sociale Invloed van Ouders en Vrienden op het Alcoholgebruik van Adolescenten. The Effect of Difference in Peer and Parent Social Influences on Adolescent Alcohol Use. Nadine

Nadere informatie

BENELUX JUNIOR WINNER

BENELUX JUNIOR WINNER Chaque année, il y aura une exposition organisée avec l octroi du titre de BENELUX WINNER dans chacun des 3 pays du Benelux (donc 3 expositions par an) en collaboration avec les sociétés canines nationales.

Nadere informatie

Zo werkt het in de apotheek (Basiswerk AG) (Dutch Edition)

Zo werkt het in de apotheek (Basiswerk AG) (Dutch Edition) Zo werkt het in de apotheek (Basiswerk AG) (Dutch Edition) C.R.C. Huizinga-Arp Click here if your download doesn"t start automatically Zo werkt het in de apotheek (Basiswerk AG) (Dutch Edition) C.R.C.

Nadere informatie

Understanding the role of health literacy in self-management and health behaviors among older adults Geboers, Bas

Understanding the role of health literacy in self-management and health behaviors among older adults Geboers, Bas University of Groningen Understanding the role of health literacy in self-management and health behaviors among older adults Geboers, Bas IMPORTANT NOTE: You are advised to consult the publisher's version

Nadere informatie

Travel Survey Questionnaires

Travel Survey Questionnaires Travel Survey Questionnaires Prot of Rotterdam and TU Delft, 16 June, 2009 Introduction To improve the accessibility to the Rotterdam Port and the efficiency of the public transport systems at the Rotterdam

Nadere informatie

3 I always love to do the shopping. A Yes I do! B No! I hate supermarkets. C Sometimes. When my mother lets me buy chocolate.

3 I always love to do the shopping. A Yes I do! B No! I hate supermarkets. C Sometimes. When my mother lets me buy chocolate. 1 Test yourself read a Lees de vragen van de test. Waar gaat deze test over? Flash info 1 In the morning I always make my bed. A Yes. B No. C Sometimes, when I feel like it. 2 When I see an old lady with

Nadere informatie

FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE. Toets Inleiding Kansrekening 1 8 februari 2010

FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE. Toets Inleiding Kansrekening 1 8 februari 2010 FOR DUTCH STUDENTS! ENGLISH VERSION NEXT PAGE Toets Inleiding Kansrekening 1 8 februari 2010 Voeg aan het antwoord van een opgave altijd het bewijs, de berekening of de argumentatie toe. Als je een onderdeel

Nadere informatie

The Royal British Legion. The Royal British Legion Holland Branch NIEUWSBRIEF JANUARI 2017 NEWSLETTER JANUARY 2017

The Royal British Legion. The Royal British Legion Holland Branch NIEUWSBRIEF JANUARI 2017 NEWSLETTER JANUARY 2017 The Royal British Legion Holland Branch The Royal British Legion Holland Branch NEWSLETTER JANUARY 2017 NIEUWSBRIEF JANUARI 2017 Message from our Chairman Bericht van onze Voorzitter Looking back on 2016

Nadere informatie

Teksten van de liederen die gospelkoor Inspiration tijdens deze Openluchtdienst zingt.

Teksten van de liederen die gospelkoor Inspiration tijdens deze Openluchtdienst zingt. Don t you worry There s an eternity behind us And many days are yet to come, This world will turn around without us Yes all the work will still be done. Look at ever thing God has made See the birds above

Nadere informatie

k ga naar school go to school

k ga naar school go to school Nederlandstalig onderwijs k ga naar school go to school Nederlands English k ga naar school go to school Wat heb ik goed geslapen. Mama helpt me bij het wassen en aankleden. Ze vertelt me dat ik mijn knuffel

Nadere informatie

150 ECG-problemen (Dutch Edition)

150 ECG-problemen (Dutch Edition) 150 ECG-problemen (Dutch Edition) John R. Hampton, Piet Machielse Click here if your download doesn"t start automatically 150 ECG-problemen (Dutch Edition) John R. Hampton, Piet Machielse 150 ECG-problemen

Nadere informatie

B1 Woordkennis: Spelling

B1 Woordkennis: Spelling B1 Woordkennis: Spelling Bestuderen Inleiding Op B1 niveau gaan we wat meer aandacht schenken aan spelling. Je mag niet meer zoveel fouten maken als op A1 en A2 niveau. We bespreken een aantal belangrijke

Nadere informatie

Night news. Fact sheets. Worksheet

Night news. Fact sheets. Worksheet 1 Night news read Het liedje van Caro Emerald speelt zich s nachts af. Lees twee nieuwsberichten die met nacht te maken hebben. Nieuwsbericht 1 Nieuwsbericht 2 Clouds block view for meteor watchers Do

Nadere informatie

Wij beloven je te motiveren en verbinden met andere studenten op de fiets, om zo leuk en veilig te fietsen. Benoit Dubois

Wij beloven je te motiveren en verbinden met andere studenten op de fiets, om zo leuk en veilig te fietsen. Benoit Dubois Wij beloven je te motiveren en verbinden met andere studenten op de fiets, om zo leuk en veilig te fietsen. Benoit Dubois Wat mij gelijk opviel is dat iedereen hier fietst. Ik vind het jammer dat iedereen

Nadere informatie

'Foreign exchange student'

'Foreign exchange student' 'Foreign exchange student' Most awesome person you will ever meet. Exchange students willingly decide to get off their asses, leave their home country, and go see the world. For that reason, they should

Nadere informatie

Duurzaam projectmanagement - De nieuwe realiteit van de projectmanager (Dutch Edition)

Duurzaam projectmanagement - De nieuwe realiteit van de projectmanager (Dutch Edition) Duurzaam projectmanagement - De nieuwe realiteit van de projectmanager (Dutch Edition) Ron Schipper Click here if your download doesn"t start automatically Duurzaam projectmanagement - De nieuwe realiteit

Nadere informatie

Erasmus Project. September 2014 Juli Maths Paths in Europe

Erasmus Project. September 2014 Juli Maths Paths in Europe Erasmus Project September 2014 Juli 2016 Maths Paths in Europe Wij : Basisschool Sint-Hendrik Gelegen in Petegem-aan-de-Leie, een deelgemeente van Deinze. Onze partners Engeland (coördinator) Spanje Italië

Nadere informatie

S e v e n P h o t o s f o r O A S E. K r i j n d e K o n i n g

S e v e n P h o t o s f o r O A S E. K r i j n d e K o n i n g S e v e n P h o t o s f o r O A S E K r i j n d e K o n i n g Even with the most fundamental of truths, we can have big questions. And especially truths that at first sight are concrete, tangible and proven

Nadere informatie

The Kentalis Reading House

The Kentalis Reading House The Kentalis Reading House Technology-facilitated enhancement of parent involvement Annet de Klerk, Loes Wauters Overview A first impression Motivation The importance of emergent literacy at home Kentalis

Nadere informatie

Update Empowermentproject Awasi Kenia september 2013

Update Empowermentproject Awasi Kenia september 2013 Update Empowermentproject Kenia september 2013 Het Empowerment-project in Kenia van de Rotaryclub Rhenen-Veendaal begint aan de derde fase: een derde en laatste bezoek, met een Empowerment workshop voor

Nadere informatie

100% VEILIG WERKEN DOE JE ZELF!

100% VEILIG WERKEN DOE JE ZELF! PROTECTION NE SUFFISENT PAS! TRAVAILLER EN TOUTE SÉCURITÉ, VOUS LE FAITES VOUS-MÊME! 00% VEILIG WERKEN 00% VEILIG WERKEN Vaak hebben werknemers wel alle persoonlijke beschermingsmiddelen om veilig te werken

Nadere informatie

This appendix lists all the messages that the DRS may send to a registrant's administrative contact.

This appendix lists all the messages that the DRS may send to a registrant's administrative contact. This appendix lists all the messages that the DRS may send to a registrant's administrative contact. Subject: 1010 De houdernaam voor #domeinnaam# is veranderd / Registrant of #domeinnaam# has been changed

Nadere informatie

ONDERWIJS TURNHOUT BEN JIJ CREATIEF MET DE COMPUTER? EDUCATION L EDUCATION SEPTEMBER 2014 TOT JANUARI 2015. Kijk dan snel op pagina 5!

ONDERWIJS TURNHOUT BEN JIJ CREATIEF MET DE COMPUTER? EDUCATION L EDUCATION SEPTEMBER 2014 TOT JANUARI 2015. Kijk dan snel op pagina 5! ONDERWIJS TURNHOUT EDUCATION L EDUCATION SEPTEMBER 2014 TOT JANUARI 2015 BEN JIJ CREATIEF MET DE COMPUTER? Kijk dan snel op pagina 5! 1 TALEN ENGELS ENGLISH L ANGLAIS Je wil graag Engels leren of je kent

Nadere informatie

Ontpopping. ORGACOM Thuis in het Museum

Ontpopping. ORGACOM Thuis in het Museum Ontpopping Veel deelnemende bezoekers zijn dit jaar nog maar één keer in het Van Abbemuseum geweest. De vragenlijst van deze mensen hangt Orgacom in een honingraatpatroon. Bezoekers die vaker komen worden

Nadere informatie

Free time! Better skills. Free time with Brenda and Brian. Worksheet

Free time! Better skills. Free time with Brenda and Brian. Worksheet 1 Free time! read a Stel je hebt een dag vrij van school. Schrijf op wat je dan gaat doen. b Lees de tekst en schrijf op welke dingen Brian en Brenda voorstellen om te doen op een vrije dag. Free time

Nadere informatie

Angststoornissen en hypochondrie: Diagnostiek en behandeling (Dutch Edition) Click here if your download doesn"t start automatically

Angststoornissen en hypochondrie: Diagnostiek en behandeling (Dutch Edition) Click here if your download doesnt start automatically Angststoornissen en hypochondrie: Diagnostiek en behandeling (Dutch Edition) Click here if your download doesn"t start automatically Angststoornissen en hypochondrie: Diagnostiek en behandeling (Dutch

Nadere informatie

Aim of this presentation. Give inside information about our commercial comparison website and our role in the Dutch and Spanish energy market

Aim of this presentation. Give inside information about our commercial comparison website and our role in the Dutch and Spanish energy market Aim of this presentation Give inside information about our commercial comparison website and our role in the Dutch and Spanish energy market Energieleveranciers.nl (Energysuppliers.nl) Founded in 2004

Nadere informatie

ALGORITMIEK: answers exercise class 7

ALGORITMIEK: answers exercise class 7 Problem 1. See slides 2 4 of lecture 8. Problem 2. See slides 4 6 of lecture 8. ALGORITMIEK: answers exercise class 7 Problem 5. a. Als we twee negatieve (< 0) getallen bij elkaar optellen is het antwoord

Nadere informatie

Een vrouw, een kind en azijn (Dutch Edition)

Een vrouw, een kind en azijn (Dutch Edition) Een vrouw, een kind en azijn (Dutch Edition) D.J. Peek Click here if your download doesn"t start automatically Een vrouw, een kind en azijn (Dutch Edition) D.J. Peek Een vrouw, een kind en azijn (Dutch

Nadere informatie

Win a meet and greet with Adam Young from the band Owl City!

Win a meet and greet with Adam Young from the band Owl City! 1 Meet and greet read Lees de tekst Wat is de prijs die je kunt winnen? Flash info early too late on time vroeg te laat op tijd Win a meet and greet with Adam Young from the band Owl City! Do you have

Nadere informatie

TOEGANG VOOR NL / ENTRANCE FOR DUTCH : https://www.stofs.co.uk/en/register/live/?regu lator=c&camp=24759

TOEGANG VOOR NL / ENTRANCE FOR DUTCH : https://www.stofs.co.uk/en/register/live/?regu lator=c&camp=24759 DISCLAIMER : 1. Het is een risicovolle belegging / It is an investment with risc. 2. Gebruik enkel geld dat u kan missen / Only invest money you can miss. 3. Gebruik de juiste procedure / Use the correct

Nadere informatie

Grammatica overzicht Theme 5+6

Grammatica overzicht Theme 5+6 Past simple vs. Present perfect simple Past simple: Ww + ed OF 2 e rijtje van onregelmatige ww. I walked I went Ontkenningen past simple: Did not + hele ww He did not walk. Present perfect: Have/has +

Nadere informatie

VRAGENKAARTJES THE ISLAND OF ALL TOGETHER

VRAGENKAARTJES THE ISLAND OF ALL TOGETHER VRAGENKAARTJES THE ISLAND OF ALL TOGETHER Dank je wel voor het downloaden van de vragenkaartjes. Graag delen we vrijblijvend een paar van onze ervaringen: 1. Wij lieten mensen eerst een minuut of tien

Nadere informatie

Meet your mentor and coach

Meet your mentor and coach Young Professional Program The importance of having a mentor in business Meet your mentor and coach What do Larry Page, and Steve Jobs have in common? They ve all received guidance from mentors. Yes even

Nadere informatie

Archief Voor Kerkelijke Geschiedenis, Inzonderheid Van Nederland, Volume 8... (Romanian Edition)

Archief Voor Kerkelijke Geschiedenis, Inzonderheid Van Nederland, Volume 8... (Romanian Edition) Archief Voor Kerkelijke Geschiedenis, Inzonderheid Van Nederland, Volume 8... (Romanian Edition) Click here if your download doesn"t start automatically Archief Voor Kerkelijke Geschiedenis, Inzonderheid

Nadere informatie

Het taalconflict in België Vlamingen gedropt in Wallonië

Het taalconflict in België Vlamingen gedropt in Wallonië Het taalconflict in België Vlamingen gedropt in Wallonië België is officieel tweetalig, maar de Vlamingen en Walen gaan niet altijd goed samen. Je kunt spreken van een taalconflict. Hoe kijken Vlaamse

Nadere informatie

Bijwoorden: meer informatie geven over een werkwoord, een bijvoeglijk naamwoord een hele zin of een ander bijwoord - uitleg

Bijwoorden: meer informatie geven over een werkwoord, een bijvoeglijk naamwoord een hele zin of een ander bijwoord - uitleg Je ziet hier een plaatje van een man die aan het lopen is. Over de manier van lopen kun je aanvullende informatie geven. The man is walking fast. The man is walking slowly. De man loopt snel. De man loopt

Nadere informatie

Programma Open dag zaterdag 28 februari 2015 Program Open Day Saturday 28 February 2015

Programma Open dag zaterdag 28 februari 2015 Program Open Day Saturday 28 February 2015 Programma Open dag zaterdag 28 februari 2015 Program Open Day Saturday 28 February 2015 Tijd 09.15 09.45 Je bent op de Open dag, wat nu? Personal welcome international visitors 10.00 10.45 Je bent op de

Nadere informatie

Welkom. in groep 1 en 2

Welkom. in groep 1 en 2 Welkom in groep 1 en 2 Beste leerling en ouder(s) / verzorger(s), Dear student and parent(s) / guardian(s), Mijn naam is Ko. Ik zit bij jou in de klas. My name is Ko. I am in your class. Op school leren

Nadere informatie

64360 BELGISCH STAATSBLAD 27.10.2010 MONITEUR BELGE

64360 BELGISCH STAATSBLAD 27.10.2010 MONITEUR BELGE 64360 BELGISCH STAATSBLAD 27.10.2010 MONITEUR BELGE FEDERALE OVERHEIDSDIENST SOCIALE ZEKERHEID N. 2010 3685 [C 2010/22451] F. 2010 3685 SERVICE PUBLIC FEDERAL SECURITE SOCIALE [C 2010/22451] 15 OKTOBER

Nadere informatie

Online Resource 1. Title: Implementing the flipped classroom: An exploration of study behaviour and student performance

Online Resource 1. Title: Implementing the flipped classroom: An exploration of study behaviour and student performance Online Resource 1 Title: Implementing the flipped classroom: An exploration of study behaviour and student performance Journal: Higher Education Authors: Anja J. Boevé, Rob R. Meijer, Roel J. Bosker, Jorien

Nadere informatie

01/ M-Way. cables

01/ M-Way. cables 01/ 2015 M-Way cables M-WaY Cables There are many ways to connect devices and speakers together but only few will connect you to the music. My Way of connecting is just one of many but proved it self over

Nadere informatie

Opening Kunst & Kultuur Pride Datum: 30 juli 2017 Locatie: Xbank Amsterdam

Opening Kunst & Kultuur Pride Datum: 30 juli 2017 Locatie: Xbank Amsterdam Opening Kunst & Kultuur Pride Datum: 30 juli 2017 Locatie: Xbank Amsterdam Beatrix Ruf & Siep de Haan foto Pieter Dammen Siep de Haan: Zondag 30 juli 2017, de opening van de Kunst & Cultuur Pride 2017

Nadere informatie

Veilig werken? Da s kinderspel! Travailler en toute sécurité? Un jeu d enfant!

Veilig werken? Da s kinderspel! Travailler en toute sécurité? Un jeu d enfant! Onze kinderen zijn onze grootste schatten. We proberen ze zo goed mogelijk af te schermen van alle potentiële gevaren. Maar met onze eigen veiligheid springen we vaak minder zorgzaam om. Met als uitgangspunt

Nadere informatie

TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN. JAARGANG 2003 Nr. 105

TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN. JAARGANG 2003 Nr. 105 74 (1977) Nr. 6 TRACTATENBLAD VAN HET KONINKRIJK DER NEDERLANDEN JAARGANG 2003 Nr. 105 A. TITEL Verdrag van Boedapest inzake de internationale erkenning van het depot van micro-organismen ten dienste van

Nadere informatie

Een vrouw, een kind en azijn (Dutch Edition)

Een vrouw, een kind en azijn (Dutch Edition) Een vrouw, een kind en azijn (Dutch Edition) D.J. Peek Click here if your download doesn"t start automatically Een vrouw, een kind en azijn (Dutch Edition) D.J. Peek Een vrouw, een kind en azijn (Dutch

Nadere informatie

Het verschil met de zinnetjes uit les1 is dat deze zinnen ontkennende zinnen zijn.

Het verschil met de zinnetjes uit les1 is dat deze zinnen ontkennende zinnen zijn. ENGLISH, WE WILL DO BETTER! LESSON TWO Beste leerling! Fijn dat je aan deze tweede les begonnen bent! We hebben het nog even over de planning van het huiswerk. Leerlingen hanteren meestal de volgende regel:

Nadere informatie

De Cambridge English presentatie voor de leerlingen. Jane West & Fokke de Jong (docenten Engels)

De Cambridge English presentatie voor de leerlingen. Jane West & Fokke de Jong (docenten Engels) De Cambridge English presentatie voor de leerlingen Jane West & Fokke de Jong (docenten Engels) CAMBRIDGE CERTIFICATE Da Vinci 2015-2016 WHO IS IT FOR? -- IT IS FOR YOU! - Do this programme if you are

Nadere informatie

Sessie Centrumsteden VVJ

Sessie Centrumsteden VVJ Sessie Centrumsteden VVJ Bram Vermeiren Steunpunt Jeugd vzw Arenbergstraat 1D I 1000 Brussel T 02 551 13 50 I F 02 551 13 85 info@steunpuntjeugd.be I www.steunpuntjeugd.be missie Jeugdwerk brengt kinderen

Nadere informatie

Quick scan method to evaluate your applied (educational) game. Validated scales from comprehensive GEM (Game based learning Evaluation Model)

Quick scan method to evaluate your applied (educational) game. Validated scales from comprehensive GEM (Game based learning Evaluation Model) WHAT IS LITTLE GEM? Quick scan method to evaluate your applied (educational) game (light validation) 1. Standardized questionnaires Validated scales from comprehensive GEM (Game based learning Evaluation

Nadere informatie

Script. Good health starts with good food. That s true for people as much as it is for animals.

Script. Good health starts with good food. That s true for people as much as it is for animals. Script Good health starts with good food. That s true for people as much as it is for animals. Livestock and fish health influence human health, since animal protein is an indispensable part of our food

Nadere informatie

DE VOLTOOID TEGENWOORDIGE TOEKOMENDE TIJD

DE VOLTOOID TEGENWOORDIGE TOEKOMENDE TIJD 1 Grammatica les 11 THE FUTURE PERFECT TENSE DE VOLTOOID TEGENWOORDIGE TOEKOMENDE TIJD 11.1 FUTURE PERFECT The Future Perfect oftewel de Voltooid Tegenwoordig Toekomende Tijd bestaat uit "will" of "shall"

Nadere informatie

PALMARÈS EXPOsciences 2015 PRIJZENLIJST wetenschapsexpo 2015

PALMARÈS EXPOsciences 2015 PRIJZENLIJST wetenschapsexpo 2015 PALMARÈS EXPOsciences 2015 PRIJZENLIJST wetenschapsexpo 2015 Prix spéciaux / Speciale prijzen Prijs voor het beste tweetalige project / Prix du bilinguisme Catalan et sa suite (Collège Saint-Michel) Zwarte

Nadere informatie

Congres Social Media, Stichting Corporate Communicatie

Congres Social Media, Stichting Corporate Communicatie Dexia & social media Frank Van ssche, Head of Brand & Project Office, Communicatie Gent, 28/04/2011 Congres Social Media, Stichting Corporate Communicatie Quotes Social media isn't (just) about the media,

Nadere informatie

Settings for the C100BRS4 MAC Address Spoofing with cable Internet.

Settings for the C100BRS4 MAC Address Spoofing with cable Internet. Settings for the C100BRS4 MAC Address Spoofing with cable Internet. General: Please use the latest firmware for the router. The firmware is available on http://www.conceptronic.net! Use Firmware version

Nadere informatie

Reading comprehension: The Tropical Rainforest

Reading comprehension: The Tropical Rainforest Auteur Laatst gewijzigd Licentie Webadres Patricia Termeer 05 februari 2016 CC Naamsvermelding 3.0 Nederland licentie https://maken.wikiwijs.nl/71971 Dit lesmateriaal is gemaakt met Wikiwijs van Kennisnet.

Nadere informatie

Danica Jiernes Madrid, 17 years

Danica Jiernes Madrid, 17 years Danica Jiernes Madrid, 17 years City of Malabon University (CMU) Bachelor of Secondary Education Major in Mathematics Mother s Occupation: Housewife (huisvrouw) Welder (lasser) I choose mathematics as

Nadere informatie

Hoe met Windows 8 te verbinden met NDI Remote Office (NDIRO) How to connect With Windows 8 to NDI Remote Office (NDIRO

Hoe met Windows 8 te verbinden met NDI Remote Office (NDIRO) How to connect With Windows 8 to NDI Remote Office (NDIRO Handleiding/Manual Hoe met Windows 8 te verbinden met NDI Remote Office (NDIRO) How to connect With Windows 8 to NDI Remote Office (NDIRO Inhoudsopgave / Table of Contents 1 Verbinden met het gebruik van

Nadere informatie

From Padua to Groningen

From Padua to Groningen From Padua to Groningen The effects of the CercleS Seminar in Padua in 2009 on writing Nederlands in gang (0-A2) Berna de Boer Benvenuti a tutti! Contents I. State of affairs in September 2009 II. The

Nadere informatie

Joos Vandewalle. wiskunde voor iedereen

Joos Vandewalle. wiskunde voor iedereen Joos Vandewalle wiskunde voor iedereen Hoe kan je het wiskundig denken laten groeien en bloeien bij alle leerlingen? Joos Vandewalle Op basis van de ideeën van Jo Boaler Youcubed Mythes over wiskunde Mythes

Nadere informatie

LONDEN MET 21 GEVARIEERDE STADSWANDELINGEN 480 PAGINAS WAARDEVOLE INFORMATIE RUIM 300 FOTOS KAARTEN EN PLATTEGRONDEN

LONDEN MET 21 GEVARIEERDE STADSWANDELINGEN 480 PAGINAS WAARDEVOLE INFORMATIE RUIM 300 FOTOS KAARTEN EN PLATTEGRONDEN LONDEN MET 21 GEVARIEERDE STADSWANDELINGEN 480 PAGINAS WAARDEVOLE INFORMATIE RUIM 300 FOTOS KAARTEN EN PLATTEGRONDEN LM2GS4PWIR3FKEP-58-WWET11-PDF File Size 6,444 KB 117 Pages 27 Aug, 2016 TABLE OF CONTENT

Nadere informatie

Duiding Strafuitvoering (Larcier Duiding) (Dutch Edition) Click here if your download doesn"t start automatically

Duiding Strafuitvoering (Larcier Duiding) (Dutch Edition) Click here if your download doesnt start automatically Duiding Strafuitvoering (Larcier Duiding) (Dutch Edition) Click here if your download doesn"t start automatically Duiding Strafuitvoering (Larcier Duiding) (Dutch Edition) Duiding Strafuitvoering (Larcier

Nadere informatie

9 daagse Mindful-leSs 3 stappen plan training

9 daagse Mindful-leSs 3 stappen plan training 9 daagse Mindful-leSs 3 stappen plan training In 9 dagen jezelf volledig op de kaart zetten Je energie aangevuld en in staat om die batterij op peil te houden. Aan het eind heb jij Een goed gevoel in je

Nadere informatie

De Relatie tussen Werkdruk, Pesten op het Werk, Gezondheidsklachten en Verzuim

De Relatie tussen Werkdruk, Pesten op het Werk, Gezondheidsklachten en Verzuim De Relatie tussen Werkdruk, Pesten op het Werk, Gezondheidsklachten en Verzuim The Relationship between Work Pressure, Mobbing at Work, Health Complaints and Absenteeism Agnes van der Schuur Eerste begeleider:

Nadere informatie

Als je zo'n zinnetje moet leren dan weet je best al wat woorden van dit zinnetje.

Als je zo'n zinnetje moet leren dan weet je best al wat woorden van dit zinnetje. ENGLISH, WE WILL DO BETTER! LESSON FIVE Beste leerling! Fijn dat je er nog steeds aan werkt om je kennis van de Engelse taal te verbeteren! Daar zul je straks in de brugklas veel voordeel van hebben! HOE

Nadere informatie

Look ahead. Find out. Worksheet. BLT Sandwich

Look ahead. Find out. Worksheet. BLT Sandwich 1 Look ahead Bekijk de tekst hieronder. Wat voor een tekst is dit? boodschappenlijst voor een feest menu voor een feestmaaltijd recept voor een bijzondere lunch BLT Sandwich Most people eat this sandwich

Nadere informatie

Healthy people want everything, sick people want only one thing. would love to see a Hospital Teacher

Healthy people want everything, sick people want only one thing. would love to see a Hospital Teacher Healthy people want everything, sick people want only one thing. would love to see a Hospital Teacher Consultant Education Sick Pupils Educational Service Centre University Medical Centre The Netherlands

Nadere informatie