TultiMouch. Een geïntegreerd, uitbreidbaar Multi Touch platform

Maat: px
Weergave met pagina beginnen:

Download "TultiMouch. Een geïntegreerd, uitbreidbaar Multi Touch platform"

Transcriptie

1 TultiMouch Eengeïntegreerd, uitbreidbaarmulti Touchplatform Projectinhetkadervanhetvak Softwarearchitectuur uitdeopleiding Masterinde Ingenieurswetenschappen:Computerwetenschappen GedoceerddoorProf.Dr.Ir.FrankGielen(vakgroepINTEC) OnderbegeleidingvanNicoGoeminne(vakgroepINTEC) Academiejaar (1 e semester) Groep8 AljoshaDemeulemeester SolutionArchitect DieterVergote JanFrederix Jean LucDeprez QualityAssuranceManager JenseSeurynck PR&LogisticsManager KristofDeSchepper Report&PresentationManager MichaëlVittorelli ConfigurationManager PieterCailliau ResearchManager PieterMees ProjectManager

2 7/12/08 TultiMouch i

3 TultiMouch Eengeïntegreerd, uitbreidbaarmulti Touchplatform Projectinhetkadervanhetvak Softwarearchitectuur uitdeopleiding Masterinde Ingenieurswetenschappen:Computerwetenschappen GedoceerddoorProf.Dr.Ir.FrankGielen(vakgroepINTEC) OnderbegeleidingvanNicoGoeminne(vakgroepINTEC) AljoshaDemeulemeester Academiejaar (1 e semester) Groep8 DieterVergote JanFrederix Jean LucDeprez JenseSeurynck KristofDeSchepper MichaëlVittorelli PieterCailliau PieterMees SolutionArchitect QualityAssuranceManager PR&LogisticsManager Report&PresentationManager ConfigurationManager ResearchManager ProjectManager 7/12/08 TultiMouch ii

4 Dankwoord Hetontwikkelenvaneensoftwarearchitectuurisgeeneenvoudigproces.Hetiseenprocesmet vele iteraties, vergaderingen, deadlines, consensussen,... Graag zouden we iedereen bedanken dieditprojectmogelijkmaakte. Gedurende twaalf weken konden we rekenen op Nico Goeminne die ons met al zijn vakkennis steedsindejuisterichtingstuurde.vanbijhetbegintotopheteindehebbenweopeenzeer aangenamemaniermethemkunnensamenwerkenenkondenwesteedsophemterugvallen! Dieter Van Rijsselbergen, projectlid Pizza UGent, gaf ons de kans kennis te maken met een bestaandemulti Touchtafel,waarvoordank. Ookwillenwegraagdemensenvanhetsecretariaat,AnBuyseenDaviniaStevens,bedankenom vooronsiedereweekeenvergaderzaalvrijtehouden. 7/12/08 TultiMouch iii

5 TableofContents Dankwoord... iii Vision... 1 Missionstatement...1 Context... 1 ValueProposition... 1 Hetplatform...1 Features...1 Scope... 1 Essentials... 2 Nice to have... 2 Stakeholders...3 ArchitecturalDrivers...3 Usability... 3 Modifiability... 3 Performance... 3 Security... 4 StateoftheArt... 5 Inleiding...5 Hardwareonderzoek...6 Multi TouchTechnologieën... 6 Devicelokalisatieen authenticatie...10 Softwareonderzoek...12 Pluggablearchitectures...12 TUIOProtocol...13 BestaandebibliothekenvoorMulti Touch...13 PrivateDesktop...16 Multi UserApplications...17 Marktstudie...19 Huidigaanbod...19 Patenten...21 Verwachtedoorbraak...22 BusinessModel Inleiding...25 Analysevandehuidigemarkt...25 Eenopensourcebibliotheek...26 ApplicationStore...26 Support&Services...26 Architecture RequirementsView...27 Inleiding...27 Lijstvanusecases...27 UitgewerkteUseCases...28 QualityAttributeScenario s...36 Inleiding...36 Usability...36 Modifiability...37 Performance /12/08 TultiMouch iv

6 UtilityTree...38 ModuleView...39 Inleiding...39 Totaaloverzicht...39 Plug ininfrastructuur...40 Multi TouchInput(MTI)...43 GUI...49 DeviceManagement...51 SessionManagement...57 ProcessView...60 Inleiding...60 Lijstvansequentiediagrammen...60 Uitwerkingsequentiediagrammen...61 InfrastructureView...85 Inleiding...85 QualityAttributes...85 Protocollen...86 MinimaleDeployment...87 MaximaleDeployment...88 Algemeenbesluit VerklarendeWoordenlijst Appendices Appendix1:CompletelijstvanFeatures /12/08 TultiMouch v

7 Vision Missionstatement Context Reeds enkele jaren maakt een nieuwe vorm van digitale input die wel eens een sterke concurrent kan worden t.o.v. de traditionele invoerapparaten zijn opmars. Multi Touch maakt het mogelijk om met meerdere inputs tegelijk op eenzelfde raakoppervlak te werken. Dit oppervlakismeestaleenbeeldscherm,maarkanbijvoorbeeldookeentouchpadvaneenlaptop zijn. Bij de ontwikkeling van Multi Touch software zijn hedendaagse ontwikkelaars vrij beperkt in hun bewegingsvrijheid, aangezien de meeste platformen een traditionele input van muis en keyboardverwachten. ValueProposition MethetprojectTultiMouchpogenweaandatprobleemtegemoettekomendooreenplatformte creërendieontwikkelaarsinstaatsteltomopeeneenvoudigemaniermulti Touchapplicatieste ontwikkelen. Belangrijke eigenschappen van dit platform zijn de uitbreidbaarheid, en de koppelingmetexterneapparaten. Hetplatform Hetzogenaamdeplatformwaaroverwesprekeniseenverzamelingvanfunctionaliteitdatmen kan gebruiken om gemakkelijk Multi Touch applicaties te bouwen; applicaties die kunnen werken in een door ons voorziene desktop omgeving. In deze desktop omgeving kunnen meerdere gebruikers verschillende applicaties opstarten, of kan er een applicatie geladen wordendiehethelescherminneemt(bijvoorbeeldeendigitaalgezelschapsspel). Features Inditgedeeltewordendeeigenschappenvanonsplatformbondiguitgelegd,onderverdeeldin drie categorieën: scope, essentials en nice to have s. De items onder scope zijn de stukken software die we in het tweede semester willen implementeren, en waarvoor we een grondig uitgewerkte architectuur zullen voorzien. De essentials behoren tot het totaalbeeld van het platform;ditzijnbelangrijkeonderdelendielaterzekergeïmplementeerdmoetenwordeninhet platform,maarwaarvoorweditenvolgendsemesterteweinigtijdhebben.tenslottevolgennog een aantal eigenschappen die minder belangrijk zijn, maar door hun toevoegende waarde het vermeldenwaardzijn denice to have s. Vooreenbeknopte,dochmeeruitgebreidelijstvanfeaturesverwijzenwenaarAppendix1. Scope Uitbreidbaarheid Zoals eerder vermeld is uitbreidbaarheid een centrale eigenschap van het platform. Dit zal mogelijk gemaakt worden door een pluggable architecture, een architectuur waarin men vrij plug inskantoevoegen,verwijderenofvervangen.dezeplug inskunnenaldannietafhankelijk zijnvanandereplug ins. 7/12/08 TultiMouch 1

8 Objectrecognitionandtracking,gestures Een andere belangrijke component in ons platform is de herkenning van objecten die in aanrakingzijnmethetmulti Touchraakoppervlak.Ditomvatzowelaanrakingenmetdehanden alsdagdagelijksevoorwerpendieopeenmulti Touchtafelkunnenliggen;eenonderscheiddat ookvoordegebruikervanhetplatformkenbaarzalzijn.verderzullenookdebewegingenvan objecten geregistreerd en beschikbaar gesteld worden. Tenslotte is het met deze informatie voorhandenrelatiefeenvoudiggestureherkenningaantebieden. Devicerelated Ontdekking,lokalisatieenidentificatie Onmisbaar bij veel Multi Touch gebruikersinterfaces is de interactie met externe apparaten; denkaaneengsmmeteenbluetoothconnectieofeenfototoesteldatkanaangeslotenworden met een USB kabel. Het platform moet voorzien zijn om m.b.v. een plug in, verbindingen te makenmetverschillendeapparatenviahuidige,eneventueeltoekomstige,technologieën. Meerconcreetzalhetplatformnieuweapparatenontdekken(discovery),zelokaliserenopeen Multi Touch tafel (localization) en tenslotte het apparaat bevragen naar zijn identiteit (identification). Interactie Eenmaal een connectie tot stand is gebracht met één of meerdere apparaten, willen we er natuurlijk mee communiceren. Bij dit onderdeel is het heel moeilijk om alle bestaande toepassingenout of the boxteondersteunen(denkbijvoorbeeldaandeverschillendebluetooth profiles). Standaard zullen we enkel filetransfer voorzien, en wordt er ruimte gelaten om door middelvanplug insextraservicestoetevoegen. GUI Indien ontwikkelaars gemakkelijk applicaties wensen te ontwikkelen voor een Multi Touch omgeving, mag een gebruiksvriendelijke bibliotheek voor het ontwikkelen van een grafische interface zeker niet ontbreken. Componenten die we zeker zullen voorzien zijn diegene die noodzakelijk geacht worden voor het uitwerken van de Private Desktop. Java Swing zal hier ongetwijfeldeengrotebronvaninspiratiezijn. AangezieneenMulti Touchopstellingindetoekomstmisschienzowelmuisalstoetsenborddoet verdwijneninbepaaldeomgevingen,moethetverliesvantekstinvoeropgevangenworden.een virtueeltoetsenborddatmakkelijkaangeroepenkanwordenvanuithetplatformisdusalzeker geenslechtideevooreenstandaardwidget. Essentials Grofweg kunnen we drie grote categorieën van features aanduiden die na de proof of concept vanditprojectverderuitgewerktmoetenworden. Zoals hierboven besproken is een uitgebreide GUI bibliotheek hier één van. Een tweede categorieheeftbetrekkingtotexterneapparaten(devices).omdeusabilityteverhogenmoeten debelangrijksteprotocolsenprotocolservices(i.h.b.bluetoothprofiles)standaardopgenomen worden in het platform. Een laatste categorie is veiligheid; de bespreking hiervan volgt in het securitygedeeltebijqualityattributes. Tenslotte vermelden we nog de automatische dependency resolver. Indien plug ins steunen op andere plug ins is het wenselijk dat er een geautomatiseerd systeem bestaat die mogelijke afhankelijkheidsproblemenautomatischkanoplossen. Nice to have Het platform zal objecten op een Multi Touch gebruikersinterface kunnen herkennen. Hiertoe behorenookafgedruktefoto sofbijvoorbeeldeena4 bladmettekst.hetistechnischgezienniet onmogelijk om (langs de achterkant van het Multi Touch schermoppervlak) hier een digitale 7/12/08 TultiMouch 2

9 afbeeldingvanhogeresolutievantenemen.opdiemanierkanmenfoto sofdocumentenheel eenvoudig digitaliseren. Eventueel kan OCR(Optical Character Recognition) toegepast worden indienerzichtekstbevindtophetpapier. Stakeholders Uit het bovenstaande blijkt duidelijk dat de belangrijkste stakeholder van het platform de ontwikkelaar van Multi Touch software is. Omdat het platform zo generiek mogelijk wordt gehouden,iserinprincipegeenrestrictieophettypesoftwaredatmenvoorhetplatformkan creëren.datneemtnietwegdatbepaaldesoftwareontwikkelaarseerdernaaronsproductzullen grijpendananderen.wedachteninditopzichtbijvoorbeeldaanontwikkelaarsvan: bord engezelschapsspellen toepassingenzoalswindowsmediacenter(indehuiskamerdooreenfoto,muziek of filmcollectiebladeren) ontwikkelaarsvanide s(aanmakenenbewerkenvangroteumldiagrammen)... Wezienechternogtweemogelijkeklassenvanstakeholdersnamelijk: Hardwarebouwersdiehetplatformkunnenintegrerenenmeeleverenmethunsystemen Eindgebruikersdierechtstreeksofonrechtstreeksincontactkomenmethetplatformvia productenvandebovenstaandestakeholders ArchitecturalDrivers WatqualityattributesbetreftkunnenwestellendatusabilitybijhetontwikkelenvaneenMulti Touch platform het belangrijkste is, kort gevolgd door modifiability en performance. De verklaring hiervoor is eerst en vooral dat het platform gebruikt zal worden door softwareontwikkelaars; en dat kan alleen als deze makkelijk hun weg vinden in de door ons verschaftewerkomgeving. Usability Om een grote usability te bereiken zal een goed gedocumenteerde hulp moeten worden voorzien, met zoekmogelijkheden en code samples voor al onze features. De leertijd moet beperktzijn.wekunnenditmetendooreenlimietteleggenopdetijddiehetmagkostenom aandehandvaneentutorialeen HelloDevice applicatietebouwen.ditiseenapplicatiewaar meneenbluetooth apparaatopdemulti Touchtafellegt,waarnaernaasthetapparaateentekst verschijnt. Het is m.a.w. belangrijk dat de programmeur heel eenvoudig toegang heeft tot devicedetectieen interactie. Tenslotte moet het mogelijk zijn om Multi Touch sofware te ontwikkelen zonder de aanwezigheid van een Multi Touch scherm. Dit kan bijvoorbeeld door de Multi Touch input in IDE stevervangendooranderebronnen(videostreams,enofanderetestdata). Modifiability Modifiabilitystaatopdetweedeplaatsomdatéénvandevoornaamstekeyfeaturespluggability is. Het moet voor de ontwikkelaar mogelijk zijn om at runtime functionele blokken aan het platformtoetevoegen,verwijderenenvervangen metdenodigesecuritybeperkingeninacht genomen. Performance Performance is ook belangrijk omdat het de usability onrechtstreeks beinvloed. Het zou voor een ontwikkelaar namelijk onaanvaardbaar zijn dat een eenvoudige applicatie zeer moeizaam draaitophetplatform.enkeleeisendiewevooronszelfopstellenzijnbijgevolg: Minstens53bewegendeblobsvlotkunnentracken. 7/12/08 TultiMouch 3

10 Eenaangename,responsievegebruikerservaring. Hetplatformmoetzelfeenminimaalaantalresourcesgebruikenenvoldoendeoverlaten voordeapplicaties. Security Security is geen prioriteit gezien het korte tijdsbestek van dit project. Indien het project voortgezetwordt,zullenvolgendesecurityattributenzekerinrekeningwordengebracht: Authorizationvandedevices,sandboxingvandeapplicaties,applicationrightsmanagement. 7/12/08 TultiMouch 4

11 StateoftheArt Inleiding De hoofdopdracht van het project is een softwarearchitectuur te bouwen rondom Multi Touch endeconnectiemetmobiledevices.inditdocumentverzamelenwedehuidigestandvanzaken rondommulti Touch. In het eerste hoofdstuk over hardware onderzoek bespreken we vooral de technologieën van Multi Touch tafels. We bespreken ook verder de mogelijkheden om mobiele toestellen te herkennenentelokaliserenopdetafel. In het tweede hoofdstuk gaan we op zoek naar bestaande software. Het eerste deel gaat over Pluggable Architectures, een mogelijke vorm van software architectuur voor het project. We refereren ook naar het TUIO protocol. We vatten de bestaande software bibliotheken voor Multi Touchsamen.Eénvanonzemogelijketoepassingenis PrivateDesktop,eensoortvan desktop op je mobiel toestel die je zou kunnen raadplegen op de Multi Touch tafel. We onderzochtenofhiervanreedsconceptenbestaan.multi UserApplicationswerdenonderzocht omdat Multi Touch tafels tenslotte door meerdere gebruikers simultaan gebruikt kunnen worden. In het derde deel doen we een markstudie naar het huidige aanbod van Multi Touch, de aanwezigepatentenendeverwachtedoorbraakvanmulti Touchbijhetgrotepubliek. 7/12/08 TultiMouch 5

12 Hardwareonderzoek Multi TouchTechnologieën We bespreken hier kort de verschillende technieken[1] die beschikbaar zijn om Multi Touch interfacesteconstrueren.bovendienvergelijkenwedevoor ennadelenvandezetechnieken. DiffusedIllumination(DI) RearDI BijRearDiffusedIlluminationwordthetschermonderaanbelichtmetIR (infrarood) licht. Een diffuser op het oppervlak verdeelt het licht evenredig over het beeld. Wanneer een voorwerp het scherm raakt reflecteert IR licht naar beneden. De camera vangt deze aanraakpunten opalshelderevlekkeninhetbeeld. RearDIwordtgebruiktindeMicrosoftSurface[2]. FrontDI In het geval van Front Diffused Illumination wordt omgevingslicht dat door het beeldscherm binnenvaltgebruikt.voorwerpendiehetschermaanrakenwerpeneenschaduwophetbeeld. Eenernstignadeelvandezetechniekisdathijvolledigafhankelijkisvanhetomgevingslicht. Waarschijnlijkzaldezedusnooitbruikbaarzijninalgemenecommerciëleapplicaties. FrustratedTotalInternalReflection(FTIR) Frustrated Total Internal Reflection[3] is gebaseerd op het optische verschijnsel dat een lichtbundel die onder een grote hoek invalt op een oppervlak volledig weerkaatst wordt. Door aandezijkantvanhetschermir bronnenteplaatsencreërenweeenlichtvlakdatpropageertin het beeldscherm zonder het te verlaten. De minimale hoek om totale interne reflectie te 7/12/08 TultiMouch 6

13 bekomenisafhankelijkvandebrekingsindexvandematerialen aan het oppervlak (glas lucht, glas vinger). Wanneer een dichter materiaal dan lucht contact maakt met het oppervlak verandert dus die hoek en is er geen totale interne reflectie meer. Een deel van het licht ontsnapt onderaan de plaat, dit vangenweopmeteenir camera. LaserLightPlane(LLP) LLPiseenvrijrecentetechniekwaarbijeenaantalIR lasersaandezijkantvanhetbeeldscherm een zeer dun IR lichtvlak genereren net boven het beeldscherm. Wanneer een object dicht genoeg bij het scherm komt reflecteert IR licht naar omlaag. Een groot voordeel van deze techniek is het zero force karakter. De gebruiker moet geen kracht uitoefenen op het scherm om het contact te kunnen registreren. Bij het construeren van dit systeem dient men echter zeer voorzichtig om te springen met de lasers.zevallenoverhetalgemeeninveiligheidsklasse 3B,ditbetekentdatzeblindheidkunnenveroorzaken. Dit is des te gevaarlijker aangezien de IR lichtbundel niet zichtbaar is en men dus geen reflex heeft om de ogentesluiten. CapacitiveTouch(CT) 7/12/08 TultiMouch 7

14 Ten slotte bestaat er ook nog Capacitive Touch[4]. Deze techniek is totaal verschillend van de voorgaande, men gebruikt elektrische capaciteit in plaats van infrarood. De techniek wordt toegepast in kleinere commerciële toepassingen die platte beeldschermen vereisen (voorgaande technieken hebben relatief veel diepte nodig)zoalsdeiphonevanapple. Men brengt op het schermoppervlak een grid van geleidende draden aan. De horizontalenoemenwe driving draden,de verticale sensing draden. Een voor een brengen we de driving draden hoog en meten sequentieel de capaciteit op elke sensing draad. Vervolgens brengen we de volgendedriving draadhoogenzovoort. Wanneer een elektrisch geladen object zich indebuurtvanhetbeeldschermbevindt,metenweeencapaciteitopdielocatie.aangezienhet menselijke lichaam ook elektrisch geladen is kunnen we deze techniek gebruiken om Multi Touchmogelijktemaken. OLEDs OLEDszijnorganischeLEDs.Zehebbenverschillendeeigenschappendiehenzeerinteressant[5] makenvoorgebruikintoekomstigedisplays.heelveelbedrijvendiemomenteellcd schermen produceren,investerennusterkinonderzoeknaardezetechnologie. Enkeleeigenschappen: Zeerplat(dikte±2mm) Homogeenlichtoverhetheleoppervlak Zeerenergie efficiënt Breedkleurenspectrummogelijk Transparantofspiegelendwanneeruitgeschakeld Plooibaredisplaysmogelijk Op 9/10/2008 publiceerde Frauhofer IPMS een persartikel[6] waarin het claimde bijna elk OLEDpaneelmeteenspeciaaluitleescircuittekunnenomvormentoteentouch gevoeligpaneel, zonder verdere aanpassingen. Dit betekent dat men in de toekomst zeer goedkoop OLED displayszalkunnenomvormennaartouchscreens. Aangezien er nog maar weinig gegevens beschikbaar zijn over deze technologie nemen we ze nietopindevergelijkinghieronder. 7/12/08 TultiMouch 8

15 Vergelijking We proberen nu de voor en nadelen van deze technieken naast elkaar te leggen. Bovendien kijken we of we een aantal interessante toepassingen die sterk technologie afhankelijk zijn kunnenrealiseren. FTIR RDI FDI LLP CT Kostprijs Dekostprijsvaneencompleteopstelling. o + o Hardwarecomplexiteit Complexiteitvandehardwarecomponent. o + Softwarecomplexiteit Complexiteitvandesoftwarecomponent. + o o + + Geslotendoos Vereist deze technologie een gesloten + + behuizing? Contrast Isereenduidelijkcontrastindetouchpunten? Dit is direct gerelateerd aan softwarecomplexiteit, hoe minder contrast + o o + + hoemeersoftwarewenodighebbenomditte compenseren. Betrouwbaarheid Levert de combinatie van hardware en softwareeenbetrouwbaarresultaatop? Pen input Kunnenwepennengebruikenomdeinterface + o o o + tebesturen? Fiducials Kunnenwefiducialsgebruikenomobjectente herkennen? Fiducials zijn een speciaal soort + o o tags die we op objecten kunnen aanbrengen omzeteidentificeren. Omgevingslicht Heeft deze techniek last van veranderend + o + omgevingslicht? Hovering Kan deze techniek detecteren of er zich een vingerindebuurtvanhetoppervlakbevindt? Scanning Kandezetechniekdocumentendiezichophet + o o oppervlakbevindeninscannen? Veiligheid Is deze techniek veilig genoeg voor commerciëletoepassingen? Referenties [1]NUIGroup( ):GettingStartedWithMulti Touch,NUIGroup[Online], [2]Derene,Glenn(72007):MicrosoftSurface:Behind the ScenesFirstLook,PopularMechanics. [Online],http://www.popularmechanics.com/technology/industry/ html?page=1. 7/12/08 TultiMouch 9

16 [3]WikipediaContributors( ):Totalinternalreflection,Wikipedia[Online], [4]Wilson,TracyV( ):HowtheiPhoneWorks,HowStuffWorks[Online], [5]PhilipsLighting BusinessCenterOLEDLighting( ):Lumiblade, [6]FraunhoferInstitutPhotonischeMikrosysteme( ):FeeltheLight:OLEDwith touchfunction,alphagalileo[online], =1. Devicelokalisatieen authenticatie Het detecteren van de aanwezigheid van een extern device is eenvoudig. Het bepalen van de positievaneenexterndeviceopdemulti Touchinterface(afgekortMTI)isdatniet,maariswel nodigomgebruiksvriendelijkheidenveiligheid(authenticatie)tekunnenrealiseren.erbestaan verschillende technieken die gebruikt kunnen worden om de plaats van een extern device te bepalenalshetzichopoftegendemti(vb.multi TouchtafelofMulti Touchwand)bevindt. Techniekendiereedsaanbodkomenindeliteratuur (Licht)Flash Eenflashwordtgegenereerddoorhetexterndevice,alsgedetecteerdwordtdathetzichopof tegendemtibevindt.eencameraindemtiregistreertdeflashenkandepositievanhetdevice bepalen. EenmogelijkscenarioisdatdeMTIeenaanvraagdoetbijhetdeviceomeenflashtegenereren wanneerhetdevicedetecteertdathetzichopoftegendemtibevindt. Dezetechnieklaattoeomopeengebruiksvriendelijkemanierauthenticatievaneengebruikerte realiseren. Een mogelijke uitwerking staat vermeld in [1]. Daarbij wordt gewerkt met een privaat/publieksleutelpaarvoorzowelhetexterndevicealsdemti.hetexterndevicegebruikt een ingebouwde versnellingsmeter of microfoon om te detecteren als het op of tegen de MTI geplaatst wordt. Daarbij laat het zijn flash afgaan en verzendt, via Bluetooth, meteen ook een authenticatieberichtnaardemti.alshetberichtcorrectvalideertendetijdtussendeflashen hetberichtkortgenoegis,danwordthetexterndevicegeauthenticeerd. 2Dbarcode tags Hetexterndevicewordt getagged meteen2dbarcode(detag)dieuniekis.viaeencamerain demtiwordtde2dbarcodegelezen,zodatdezeweetoverwelkdevicehetgaat,vervolgenskan eenvoudig de plaats bepaald worden. Een grote speler die deze techniek gebruikt is Microsoft methunsurface[4]. Authenticatievandevicesenkelgebaseerdoptagsisnietveiligvermitseentaggekopieerdkan worden. RFID tags Hetexterndevicewordt getagged meteenrfid tagdieuniekis.detagbevatbijvoorbeeldeen privaat/publiek sleutelpaar. Via een RFID sensor, die best een klein bereik heeft en die net onderhetmtioppervlakaangebrachtwordt,kanbepaaldwordenofeendevicezichop,tegenof heeldichtindebuurtvandemtibevindtenopwelkepositie.ditlaatooktoeomopeenvoudige wijzeauthenticatieuittevoeren.concreteuitwerkingenzijnernogniet,maardetechniekwordt welveelvermeld. 7/12/08 TultiMouch 10

17 Techniekendienietindeliteratuurvoorkomen,maarwelbruikbaarzijn Trilfunctie Het device genereert (via de trilfunctie) drukgolven doorheen het oppervlak van de MTI. DruksensoreninderandenvandeMTIvangendedrukgolvenopenkunnenaandehandvande amplitudesbepalenwaarhetdevicezichbevindt. Gesture Bij het detecteren van externe devices, vraagt de MTI, via het scherm van dat device, aan de gebruiker om een bepaalde gesture rond of in de buurt van het device te maken om het te lokaliseren. NotificatieopdeMTIvoorandersnietlokaliseerbaredevices Sommige devices(bijvoorbeeld usb flash memory) beschikken niet over de mogelijkheden om lokalisatie toe te laten. Deze worden dan visueel op de MTI weergegeven bijvoorbeeld als een oplichtend icoontje in de hoek of een afbeelding van het device op de meest waarschijnlijke plaats. Besluit DevicelokalisatieismogelijkopdeMTIenkanvoorsommigeapparatenookgebruiksvriendelijk enveiligverlopen. Referenties [1]JohannesSchöning,MichaelRohs,AntonioKrüger( ):UsingMobilePhonesto SpontaneouslyAuthenticateandInteractwithMulti TouchSurfaces,WebsiteMichaelRohs, [Online],http://www.deutsche telekom laboratories.de/~rohs/papers/schoening PhoneFlash PPD08.pdf [2]WikipediaContributors( ):Barcode,Wikipedia,[Online], [3]JunRekimoto,YujiAyatsuka(2000):CyberCode:DesigningAugmentedReality EnvironmentswithVisualTags,WebsiteJunRekimoto[Online], [4]RobertScoble( ):MoreonMicrosoft ssurfacecomputinginitiatives.scobleizer, [Online],http://scobleizer.com/2007/05/30/more on microsofts surface computing initiatives [5]Microsoft():HowdoesMicrosoftSurfacework?MicrosoftSurfaceFAQwebpagina,[Online], [6]AliMazalek(2006):TangibleToolkits:IntegratingApplicationDevelopmentacrossDiverse Multi UserandTangibleInteractionPlatforms,WebsiteAliMazalek,[Online], toolkits.pdf 7/12/08 TultiMouch 11

18 Softwareonderzoek IndithoofdstukgaanweopzoeknaarreedsbestaandesoftwarevoorMulti Touchtafelsalsook naar bestaande software of software concepten die we mogelijk kunnen overnemen in ons project. Pluggablearchitectures OSGi Het Eclipse platform [1][2], dat als het grootte voorbeeld voor een pluggable software architectuurmagwordengezien,voorzieteenframeworkwaarontwikkelaarsaandehandvan plug ins extra functionaliteit kunnen aan toevoegen, namelijk OSGi. Het basismechanisme van de uitbreidbaarheid van deze ontwikkelomgeving bestaat erin dat plug ins nieuwe verwerkingselementenkunnentoevoegenaanbestaandeplug ins.eclipsevoorzieteensetvan basisplug insomditprocestevergemakkelijken. HetOSGiframeworkbestaatuiteenaantallagen.Deeerstelaag is de Excecution Environment, zoals J2SE. De laag Modules definieert de class loading policies. De Life Cycle laag voegt Bundles (ook plugins genoemd) toe die dynamisch kunnen geïnstalleerdworden.erisooknogeenserviceregistrydieeen royaal model levert om objecten uit te wisselen tussen de bundles.erliggenbepaaldeeventsvastomhetkomenengaan vanbundlestenotifiëren.meerinformatieistevindenop[3]. Microkernel Het Microkernel architecturaal ontwerp patroon [4] wordt toegepast voor software systemen dieinstaatmoetenzijnomzichaantepassenaanveranderendesysteemvereisten.hetscheidt deminimalefunctionelekernvandemeeruitgebreidefunctionaliteitenenklantspecifiekedelen. Demicrokerneldientalseen socket waarindeextensieswordengeplaatstencoördineerthun samenwerking. Reflection Het Reflection architecturaal ontwerppatroon [4] voorziet mechanismen om dynamisch de structuur en het gedrag van een softwaresysteem te veranderen. Het ondersteunt de veranderingvanfundamenteleaspecten,zoalstype,structuurenhet functioncall mechanisme. In dit patroon wordt een applicatie in twee delen opgesplitst. Het metaniveau voorziet informatieoverenkelegeselecteerdesysteemeigenschappenenmaaktdesoftware bewust van zichzelf.hetbasisniveaubestaatuitdeapplicatielogica.deimplementatievanditniveausteunt ophetmetaniveau.eenveranderingvaninformatieinhetmetaniveaubeïnvloedthetgedragvan hetbasisniveau. Referenties [1]AzadBolour(3juli2003):NotesontheEclipsePlug inarchitecture,eclipse,[online], Plug in architecture/plugin_architecture.html [2]Gamma,K.Beck(20Oktober2003):ContributingtoEclipse:Principles,Patterns,andPlug Ins,AddisonWesley [3]OSGiAlliance():OSGiTechnology,OSGi,[online],http://www.osgi.org/About/Technology 7/12/08 TultiMouch 12

19 [4]F.Buschmann,R.Meunier,H.Rohnert,P.Sommerlad,M.Stal(2001):Pattern oriented softwarearchitecture,asystemofpatterns,wiley TUIOProtocol Het TUIO Protocol [1] is een open source specificatie voor de communicatie tussen de Multi Touchinterface(vingerdetectie,gestures,objecten, )enbovenliggendeapplicatielagen. Het protocol abstraheert vingers, gestures en objecten op de interface naar ID s, coördinaten, rotatiesensnelheden.bovendienondersteunthetverschillendeprofielen,elkaangepastaaneen specifieksoortinterface(2d,2.5den3d). Referenties [1]MartinKaltenbrunner,TillBovermann,RossBencina,EnricoCostanza():TUIOProtocol Specification,Reactable,[Online],http://reactable.iua.upf.edu/?tuio BestaandebibliothekenvoorMulti Touch Touchlib Touchlib[1]iseenbibliotheekvoorhetmakenvanMulti Touchoppervlaktes.Hetkaninfrarode puntentracerenenzendtdandezeinformatiezoalsbijvoorbeeld'vingerneer','vingerbewogen' en 'vinger losgelaten' naar de gebruikersprogramma's. Touchlib komt met een configuratieapplicatie en enkele voorbeelden meegeleverd zodat het gemakkelijk gestart kan worden. Het kan interageren met de meeste types webcams en video opnameapparatuur. MomenteelwerkthetenkelonderWindowsmaarerwordeninspanningengedaanomhetook opandereplatformentelatenwerken. VanafdehuidigeversiekanTouchlibgebeurtenissenverspreidenviahetTUIO[2]protocol(dit gebruiktosc)(zievroeger).ditmaakttouchlibcompatibelmetveelandereapplicatiesdiedit protocolondersteunenzoalsflash[3],vvvv[4],processing[5],puredata[6],...ditmaakthet ook mogelijk om Touchlib te gebruiken voor de detectie en het traceren van punten terwijl zoiets als VVVV of Processing gebruikt wordt om klantapplicaties te schrijven. De gebruiker beslist.hettuioprotocolondersteunenlaatookeengedistribueerdearchitectuurtoewaareen machine zich kan concentreren op de detectie en het traceren en een andere machine de applicatiekanuitvoeren. Tbeta Tbeta[7] is een vernieuwde versie van Touchlib, een open source bibliotheek voor het ontwikkelen van Multi Touch applicaties gemaakt door Nuigroup voor het detecteren van aanraakgebeurtenissen.denieuwetbetaisechtergebouwdophetopenframeworks[8],opdie manier is het cross platform, cross compiler en het nodigt de gebruiker uit om een grafische interfacetebouwenvoorzijnmulti Touchsoftware. OpenTouch BBTouch OpenTouch[8]iseenoplossingvoordeontwikkelingvanmulti modaleapplicaties.hetdoelvan dit softwareproject is een open source framework te bouwen dat de input van multi modale toestellen zoalsmulti TouchschermengebaseerdopFTIR behandeltenverwerkt.hetlaat bewegingsgestuurde, meerdere punten interfaces en een niet programmeer aanpak voor bewegingsgestuurdeprototypestoe. Het OpenTouch platform heeft tot doel de laag tussen het input toestel en de uiteindelijke grafischeapplicatietezijn.hetisontworpenomcross platformtezijnmetondersteuningvoor interneenexterneapplicatiesalssimpelegateway,punttracering,bewegingsherkenningenveel meer. 7/12/08 TultiMouch 13

20 libavg libavg [9] is een hoog niveau multimedia platform dat zich concentreert op interactieve installaties.hetneemtdedraadopwaarmacromediadirectorenadobeflashstoppenengeeft zowelhogekwaliteit,hardwareversneldebeeldenalseengemakkelijkeenflexibeleauthoring, testing en opzetting. libavg werkt goed met andere open source oplossingen voor geluid, netwerkenenhardwareapparatuurondersteuning.ditgeefteencompleetengoedgeïntegreerd pakket.hetgebruikteenxmlgebaseerdelay outtaalvoorhetgrafischontwerpenpythonals scriptingtaal. MPX De Multi Pointer X Server (MPX) [10] is een aanpassing van X server [11]. Een standaard X Server beschikt slechts over één muiscursor en één toetsenbord focus, ongeacht het aantal verbonden inputapparaten. MPX geeft de gebruiker meerdere muiscursors en meerdere toetsenbordfocussen.multi Cursorapplicatieszijninhetverledenookalontwikkeld,maarMPX is de eerste implementatie van een multicursor windowing systeem (of een Multi Cursor X server). MPX toestellen zijn onafhankelijk. Elke cursor is een echte systeemcursor en verschillende aanwijzerskunnentegelijkwerkeninmeerdereapplicaties.ditlaateentweehandigeinteractie en/of samenwerking op één scherm toe. MPX is compatibel met bestaande applicaties zoals GIMP,deFirefoxwebbrowserenverschillendeandereapplicaties.Toetsenbordenzorgenvoor meerdere toetsenbord focussen. Zo kan je uiteindelijk in meerdere applicaties tegelijk typen. Zowelmuizenentoetsenbordenzijnhot plugged. MPX is merkelijk verschillend van oplossingen zoals cpnmouse [12], SDGToolkit [13], MIDDesktop [14] en andere toolkits of applicaties. Het is vrij eenvoudig om op de meeste besturingssystemen een applicatie of toolkit te schrijven om meerdere inputapparaten te ondersteunen.tegelijknieuweenbestaandeapplicatiesondersteunenisalheelwatmoeilijker. MPX verandert het windowing systeem, de omgeving voor alle grafische applicaties. Op deze manier zijn bestaande applicaties ondersteund en krijgen deze extra mogelijkheden. Nieuwe applicatieskunnentegelijkdemulti aanwijsmogelijkhedengebruikenendusnieuwemanieren vaninteractieimplementeren.datiswaaromwijdenkendathetwindowingsysteemdegoede plaatsisomondersteuningvoormeerdereinputapparatenintebouwen. OpenTable(Jetmesa) OpenTable [15] is een Multi Touch Java gebaseerde gebruikersinterface voor computers geïntegreerdineentafel. HetOpenTableprojectiseenopensourceinitiatiefomJavagebaseerde,multi platformenmulti Touchapplicatieplatformenteontwikkelen.Met platform wordtzowelhardwarealssoftware bedoeld. Het doel is om een generisch framework aan te bieden dat ondersteuning zal bieden aan alle bestaande hardware installaties (FTIR, DI/DIR,...) en om het even welk aantal configuraties (meerderecamera's,meerderecomputers,muren,tafels,plafonds,...misschienzelfseenmulti Touchbroodrooster). Op dit moment wordt de software ontwikkeld en worden er plannen (en kits) beschikbaar gesteldomjeeigenmulti Touchinstallatietebouwen. De naam van het project is onlangs officieel veranderd naar Jetmesa, maar het project is nog altijdvoornamelijkgekendonderzijnoudenaamopentableenwordtdaaromookhiernogzo vermeld. Dotnetmtf Dotnetmtf [16][17] is een volledig framework om Multi Touch applicaties op het.net 3/3.5 platformteontwikkelen. 7/12/08 TultiMouch 14

Multi-touch screen. Abstract

Multi-touch screen. Abstract Multi-touch screen Abstract Auteur: Nick Van den Vonder & Dennis De Quint Promotoren: Jeroen Doggen, Artesis Hogeschool Antwerpen Kristof Valkenborgh, Item Solutions 10 Juli 2009 Inleiding Om de driejarige

Nadere informatie

Zelftest Java concepten

Zelftest Java concepten Zelftest Java concepten Document: n0838test.fm 22/03/2012 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INLEIDING BIJ DE ZELFTEST JAVA CONCEPTEN Om de voorkennis nodig

Nadere informatie

i3sync PLUG & PLAY DRAADLOOS PRESENTATIE MIDDEL

i3sync PLUG & PLAY DRAADLOOS PRESENTATIE MIDDEL i3sync PLUG & PLAY DRAADLOOS PRESENTATIE MIDDEL VERANDER DE MANIER WAAROP U VERGADERT Of geef presentaties met dit compacte en lichtgewicht presentatie device. De i3sync is eenvoudig te gebruiken en stelt

Nadere informatie

Werkomgeving. Android Studio. Android - werkomgeving 1/6

Werkomgeving. Android Studio. Android - werkomgeving 1/6 Android - werkomgeving 1/6 Werkomgeving Android Studio Installatie Ga naar de volgende URL: http://developer.android.com/sdk/index.html Klik op de knop "Download Android Studio for Windows" om het programma

Nadere informatie

CTOUCH. Touchscreens. Multi Touch

CTOUCH. Touchscreens. Multi Touch CTOUCH CTOUCH introduceert een nieuwe lijn groot formaat interactieve LED displays. De nieuwe lijn, Leddura genaamd, is verkrijgbaar in de range van 47 (119cm), 55, 65, 70 en 80 inch (203cm). Het nieuwe

Nadere informatie

Altijd en overal online?

Altijd en overal online? Altijd en overal online? Smartphone Tablet E-Reader Netbook Notebook Chromebook Smartphones Bekende merken en types: Apple iphone 4 Samsung Galaxy S II HTC Desire HD Blackberry bold Steeds minder: Nokia

Nadere informatie

CTOUCH. Touchscreens. Multi Touch

CTOUCH. Touchscreens. Multi Touch CTOUCH CTOUCH introduceert een nieuwe lijn groot formaat interactieve LED displays. De nieuwe lijn, Leddura genaamd, is verkrijgbaar in de range van 47 (119cm), 55, 65, 70 en 84 inch (213cm). Het nieuwe

Nadere informatie

BuildingOn WebOTP. www.buildingon.com

BuildingOn WebOTP. www.buildingon.com BuildingOn WebOTP Nieuw USB token voor sterke web authenticatie www.buildingon.com Wat is WebOTP WebOTP is een complete innovatie op het gebied van web authenticatie. De belangrijkste eigenschap van deze

Nadere informatie

Uitgebreid eindwerkvoorstel Lokaliseren van personen en objecten met behulp van camera s

Uitgebreid eindwerkvoorstel Lokaliseren van personen en objecten met behulp van camera s Uitgebreid eindwerkvoorstel Lokaliseren van personen en objecten met behulp van camera s Sofie De Cooman 21 December 2006 Stagebedrijf: Interne begeleider: Externe begeleider: BarcoView Koen Van De Wiele

Nadere informatie

Waarmaken van Leibniz s droom

Waarmaken van Leibniz s droom Waarmaken van Leibniz s droom Artificiële intelligentie Communicatie & internet Operating system Economie Computatietheorie & Software Efficiënt productieproces Hardware architectuur Electronica: relais

Nadere informatie

Design for Mobile. Projectplan CMD jaar 2. Remco Dekker Daan van Klinken Sybren Wartna CMD3A UXD

Design for Mobile. Projectplan CMD jaar 2. Remco Dekker Daan van Klinken Sybren Wartna CMD3A UXD I C I Projectplan CMD jaar 2 Remco Dekker Daan van Klinken Sybren Wartna CMD3A UXD INHOUDSOPGAVE IPHONE PLATFORM 3 DE IPHONE 4 APPS 5 AAN DE SLAG MET APPS 6 BRIEFING 7 KONGINNEDAG 8 LOWLANDS 9 BUSINESS

Nadere informatie

USABILITY VOOR HET WEB EN MOBIELE APPARATEN PETER KASSENAAR

USABILITY VOOR HET WEB EN MOBIELE APPARATEN PETER KASSENAAR USABILITY VOOR HET WEB EN MOBIELE APPARATEN PETER KASSENAAR WELKOM AGENDA Introductie Korte algemene inleiding Usability Usability voor mobiele apparaten Vragen - afsluiting INTRODUCTIE Peter Kassenaar;

Nadere informatie

Projectdocument Minecraft Mod Builder

Projectdocument Minecraft Mod Builder Projectdocument Minecraft Mod Builder Projectgroep Twintro 11 december 2015 Inhoudsopgave 1 Probleemstelling 2 2 Productbeschrijving 2 3 Requirements analyse 3 3.1 Functional requirements................................

Nadere informatie

Werkplekvisie. Hans van Zonneveld Senior Consultant Winvision

Werkplekvisie. Hans van Zonneveld Senior Consultant Winvision Werkplekvisie Hans van Zonneveld Senior Consultant Winvision De essentie De gebruiker centraal Verschillende doelgroepen Verschillende toepassingen Verschillende locaties Het beschikbaar

Nadere informatie

Responsive web applicaties op Oracle

Responsive web applicaties op Oracle APEX Responsive web applicaties op Oracle Spreker(s) : Datum : E-mail : Arian Macleane & Jacob Beeuwkes 06-06-2013 info@transfer-solutions.com WWW.TRANSFER-SOLUTIONS.COM Outline Trends APEX intro APEX

Nadere informatie

i3sync DRAADLOOS PLUG & PLAY PRESENTATIE DEVICE

i3sync DRAADLOOS PLUG & PLAY PRESENTATIE DEVICE i3sync DRAADLOOS PLUG & PLAY PRESENTATIE DEVICE VERANDER DE MANIER WAAROP U VERGADERT Verander de manier waarop u vergadert of presenteert dankzij dit compacte en lichte presentatie device. i3sync is gebruiksvriendelijk

Nadere informatie

PRIJSLIJST EINDVERBRUIKER 3de Kwartaal 2013 B2B. Grootformaat Touch-screen LED monitoren voor presentaties. 5e Generatie

PRIJSLIJST EINDVERBRUIKER 3de Kwartaal 2013 B2B. Grootformaat Touch-screen LED monitoren voor presentaties. 5e Generatie PRIJSLIJST EINDVERBRUIKER 3de Kwartaal 2013 B2B Grootformaat Touch-screen LED monitoren voor presentaties 5e Generatie Prijzen geldig van 1 juli t/m 30 september 2013 Voordelen Focus Touch Het Focus Touch

Nadere informatie

Hoofdstuk 2. - is verantwoordelijk voor de communicatie van de software met de hardware.

Hoofdstuk 2. - is verantwoordelijk voor de communicatie van de software met de hardware. Hoofdstuk 2 2.1 systeembeheerprogramma s Werking en functies van besturingssystemen Besturingssysteem/operating systeem(os) - is verantwoordelijk voor de communicatie van de software met de hardware. -

Nadere informatie

Programmeren in C ++ met wxwidgets les 5

Programmeren in C ++ met wxwidgets les 5 Elektrotechniek/Embedded Systems engineering inf2d Programmeren in C ++ met wxwidgets les 5 cursus 2009-2010 ir drs E.J Boks Les 5 Grafische toolkits Basisbeginselen gebruik grafische toolkit WxWidgets

Nadere informatie

Focus Touch. Touchscreens

Focus Touch. Touchscreens Focus Touch Met een grootformaat Focus Touch LED monitor bestuurt u via Optical Dual Touch de computer door middel van een aanraking op het scherm. Dit kan met uw vinger of bijvoorbeeld met een pen. Zo

Nadere informatie

Windows 10. 2015 Training voor 50-plussers. PC50plus trainingen Eikbosserweg 52 1214AK Hilversum tel: 035 6213701 info@pc50plus.nl www.pc50plus.

Windows 10. 2015 Training voor 50-plussers. PC50plus trainingen Eikbosserweg 52 1214AK Hilversum tel: 035 6213701 info@pc50plus.nl www.pc50plus. 2015 Training voor 50-plussers PC50plus trainingen Eikbosserweg 52 1214AK Hilversum tel: 035 6213701 info@pc50plus.nl www.pc50plus.nl Windows 10 TRAINING VOOR 50- PLUSSERS Inhoud opgave. Pagina 01-0 7

Nadere informatie

Data Acquisitie in een modern jasje. Wordt het de tablet of toch iets anders?

Data Acquisitie in een modern jasje. Wordt het de tablet of toch iets anders? Data Acquisitie in een modern jasje. Wordt het de tablet of toch iets anders? Marco Bischoff Yokogawa Europe BV 7 november 2013 Yokogawa IA Control Products --- Business domain Technologischeontwikkelingen

Nadere informatie

Unicomedia biedt een totaal oplossing voor narrowcasting en adviseert over hardware, implementatie en beheer van deze netwerken.

Unicomedia biedt een totaal oplossing voor narrowcasting en adviseert over hardware, implementatie en beheer van deze netwerken. Retail Digital Signage heeft zich in verschillende vormen effectief bewezen om doelgericht met consumenten te communiceren. Digitale media wordt ingezet om merkenherkenning te ondersteunen, winkel promoties

Nadere informatie

Mobiel werken. 15.12.10 Mobiel Werken Sven Moreels 1

Mobiel werken. 15.12.10 Mobiel Werken Sven Moreels 1 Mobiel werken 15.12.10 Mobiel Werken Sven Moreels 1 Inhoud: Definitie van Mobiel werken Wat heb je nodig om mobiel te werken? Historiek mobiele connecties Historiek van de toestellen Operating systems

Nadere informatie

Wat is Arduino? Arduino = microprocessor (Atmel)

Wat is Arduino? Arduino = microprocessor (Atmel) Intro tot Arduino Wat is Arduino? Volgens de website: Arduino is an open-source electronics prototyping platform based on flexible, easy-to-use hardware and software. It's intended for artists, designers,

Nadere informatie

Software hoofdstuk 1. 1. Wat is de functie van een besturingssysteem? 2. Welke hoofdtaken heeft het besturingssysteem?

Software hoofdstuk 1. 1. Wat is de functie van een besturingssysteem? 2. Welke hoofdtaken heeft het besturingssysteem? Software hoofdstuk 1 1. Wat is de functie van een besturingssysteem? Een besturingssysteem ( in het Engels operating system of afgekort OS) is een programma (meestal een geheel van samenwerkende programma's)

Nadere informatie

UBUNTU. Vandaag had ik voorzien om een opstart-cd of usb te maken om je pc op linux op te starten. Open source. Gratis software UBUNTU

UBUNTU. Vandaag had ik voorzien om een opstart-cd of usb te maken om je pc op linux op te starten. Open source. Gratis software UBUNTU Open source UBUNTU UBUNTU Gratis software Vandaag had ik voorzien om een opstart-cd of usb te maken om je pc op linux op te starten We gaan eerst de software op onze pc zetten in het mapje download Eerst

Nadere informatie

HTML. Media. Hans Roeyen V 3.0

HTML. Media. Hans Roeyen V 3.0 Media Hans Roeyen V 3.0 12 maart 2015 Inhoud 1. (Multi)Media op websites... 3 2. Flash en Websites... 4 3. Video op je website... 4 3.1. YouTube insluiten op de pagina... 4 3.2. Video zonder YouTube...

Nadere informatie

Indoor Navigation System

Indoor Navigation System Project Indoor Navigation System Onderwerp: Indoor Navigation System Document: Handleiding Ontwikkeltools Groep: EII6RTa Auteurs: 1. Jordi Betting 109277 2. Jerome Bos 113180 3. Theo Miltenburg 112883

Nadere informatie

01/05. Websites Nederland over. Mobile marketing. Whitepaper #03/2013. Mabelie Samuels internet marketeer

01/05. Websites Nederland over. Mobile marketing. Whitepaper #03/2013. Mabelie Samuels internet marketeer 01/05 Websites Nederland over Mobile marketing Mabelie Samuels internet marketeer 02/05 Mobile marketing Kunt u zich uw eerste mobiele telefoon nog herinneren? Die van mij was een Motorola, versie onbekend,

Nadere informatie

Marlin Family. Marlin

Marlin Family. Marlin PCA Mobile PCA Mobile Organisatie PCA Mobile BV maakt deel uit van de Mobile Solution Group en biedt met ruim 40 enthousiaste collega s een veelomvattend pakket van innovatieve en gebruiksvriendelijke

Nadere informatie

Desktop, Laptop, Netbook, Ultrabook or Tablet? Which is best for what? Keuzes maken

Desktop, Laptop, Netbook, Ultrabook or Tablet? Which is best for what? Keuzes maken Desktop, Laptop, Netbook, Ultrabook or Tablet? Which is best for what?. Keuzes maken Wanneer je een computer wilt aanschaffen denk je tegenwoordig niet meteen meer aan de desktop. De desktop is een "grote"

Nadere informatie

Windows XP Migratie opties. Bart van Dijk (b.van.dijk@hccnet.nl)

Windows XP Migratie opties. Bart van Dijk (b.van.dijk@hccnet.nl) Windows XP Migratie opties Bart van Dijk (b.van.dijk@hccnet.nl) Windows XP Migratie opties Wat is het probleem met Windows XP De opties te vervanging van Windows XP Migratie naar Linux Mint Probleem met

Nadere informatie

Thin-Clients architectuur bij een farmaceutisch bedrijf.

Thin-Clients architectuur bij een farmaceutisch bedrijf. Thin-Clients architectuur bij een farmaceutisch bedrijf. Vincent Wagenaar Raster Products BV (vw@raster-products.com) Erik van Noort Strypes Nederland BV (erik.van.noort@merck.com) Raster Products B.V.

Nadere informatie

Les 11: systeemarchitectuur virtuele machines

Les 11: systeemarchitectuur virtuele machines Les 11: systeemarchitectuur virtuele machines Geavanceerde computerarchitectuur Lieven Eeckhout Academiejaar 2008-2009 Universiteit Gent Virtuele machines Motivatie Interfaces Virtualisatie: inleiding

Nadere informatie

Foto en Specificaties

Foto en Specificaties Foto en Specificaties 5,3 inch TFT IPS with qhd resolution (960 x 540) - Android OS, v4.1 (Jelly Bean) - Intern geheugen: 16GB storage, 1 GB RAM - CPU: Dual-core 1.2 GHz Cortex-A9 Processor - Chipset:

Nadere informatie

ArcGIS Mobile ADF. Smart Client Applicaties voor ArcGIS Server Eva Dienske, Wim Ligtendag

ArcGIS Mobile ADF. Smart Client Applicaties voor ArcGIS Server Eva Dienske, Wim Ligtendag ArcGIS Mobile ADF Smart Client Applicaties voor ArcGIS Server Eva Dienske, Wim Ligtendag Agenda Wat is de Mobile ADF? Architectuur Demo Wat is de mobile ADF? Ontwikkeltoolkit voor mobiele (Smart Client)

Nadere informatie

Windows Phone 8S HTC

Windows Phone 8S HTC Een nieuwe, meer persoonlijke user interface Design DNA van HTC HTC Proprietary and Confidential De lichtste Windows Phone met Beats Audio Iconisch Design HTC ontwierp de Windows Phone 8S door het virtuele

Nadere informatie

Dicht het security gat - Microsoft SharePoint, OCS, en Exchange met Secure File Sharing Heeft uw organisatie ook een Dropbox probleem?

Dicht het security gat - Microsoft SharePoint, OCS, en Exchange met Secure File Sharing Heeft uw organisatie ook een Dropbox probleem? Dicht het security gat - Microsoft SharePoint, OCS, en Exchange met Secure File Sharing Heeft uw organisatie ook een Dropbox probleem? Executive summary Organisaties maken meer en meer gebruik van online

Nadere informatie

Is APEX a worthy substitute for Oracle Forms?

Is APEX a worthy substitute for Oracle Forms? your oracle solu+ons partner Is APEX a worthy substitute for Oracle Forms? APEX for mission critical applications: the Groupm business-case By Ronny Boeykens & Stijn Van Raes iadvise o Opgericht in 2004

Nadere informatie

USABILITY VOOR HET WEB EN MOBIELE APPARATEN PETER KASSENAAR

USABILITY VOOR HET WEB EN MOBIELE APPARATEN PETER KASSENAAR USABILITY VOOR HET WEB EN MOBIELE APPARATEN PETER KASSENAAR WELKOM AGENDA Introductie Korte algemene inleiding Usability Usability voor mobiele apparaten Vragen - afsluiting INTRODUCTIE Peter Kassenaar;

Nadere informatie

Interactief, real time security management

Interactief, real time security management P2000 en P2000LE SECURITY MANAGEMENT SYSTEEM Interactief, real time security management P2000 Security Management Systeem Schaalbaar, intuïtief en eenvoudig in gebruik Het Johnson Controls P2000 security

Nadere informatie

m.b.v. digitale certificaten en PKI Versie: mei 2002 Beknopte Dienstbeschrijving beveiligen van VPN s

m.b.v. digitale certificaten en PKI Versie: mei 2002 Beknopte Dienstbeschrijving beveiligen van VPN s Beknopte dienstbeschrijving Beveiligen van VPN's m.b.v. digitale certificaten en PKI Document: Versie: mei 2002 Beknopte Dienstbeschrijving beveiligen van VPN s Inhoudsopgave 1. Inleiding 2 2. Snel te

Nadere informatie

Virtueel of Fysiek. Uitdagingen bij migratie naar Windows 7

Virtueel of Fysiek. Uitdagingen bij migratie naar Windows 7 Het jaar 2011/2012 staat voor veel organisaties in het teken van Windows 7. De overstap van Windows XP naar Windows 7 lijkt in eerste instantie eenvoudig te zijn maar blijkt in de praktijk toch complex.

Nadere informatie

Verhuuroverzicht Touchscreens, Touchtafels, Large displays, LCD monitoren

Verhuuroverzicht Touchscreens, Touchtafels, Large displays, LCD monitoren Touchscreens, Touchtafels, Large displays, LCD monitoren Touchtafels Philips 42 multi-touch table PT-GT-55 Smart Table-32 Touchscreen / multi-touch / multi-user-touch PT-M-19W Philips Large LCD (touch)display

Nadere informatie

Leerscenario Kata-App (werktitel) Raymond Stoops Hogeschool Utrecht. Analyse. Inleiding. Doelstellingen

Leerscenario Kata-App (werktitel) Raymond Stoops Hogeschool Utrecht. Analyse. Inleiding. Doelstellingen Leerscenario Kata-App (werktitel) Raymond Stoops Hogeschool Utrecht Analyse Inleiding Bij het beoefenen van karate zijn er meerdere trainingsvormen. Een individuele trainingsvorm is de kata, waar een vast

Nadere informatie

ZoomText 10.1 Bijlage bij de Quick Reference Guide

ZoomText 10.1 Bijlage bij de Quick Reference Guide ZoomText 10.1 Bijlage bij de Quick Reference Guide Deze bijlage bij de ZoomText 10 Quick Reference Guide beschrijft nieuwe functies en andere veranderingen die specifiek zijn aan ZoomText 10.1. Voor instructies

Nadere informatie

High Performance Computing

High Performance Computing High Performance Computing Kristian Rietveld (krietvel@liacs.nl, kamer 138) Groep Computer Systems - Embedded systems - Specifieke software mappen op specfieke hardware. - Hardware synthesis. - Real-time

Nadere informatie

Linux en Open Source

Linux en Open Source Linux en Open Source Computer - Besturingssyteem Besturingssysteem Windows OS X Linux Software Open Source Closed Source Broncode Vrij beschikbaar Door iedereen te controleren en te gebruiken Geen licentiekost

Nadere informatie

9200 DENDERMONDE WAUTERS Marcel PC Technieken / 03 Soorten computers

9200 DENDERMONDE WAUTERS Marcel PC Technieken / 03 Soorten computers Soorten computers 1 Classificatie volgens hiërarchie De technische term voor een computer zoals we die nu kennen is micro data processor, kortweg PC. De PC stond bij zijn ontstaan begin jaren 80 onderaan

Nadere informatie

Haal meer uit het onderwijs met interactieve touch displays!

Haal meer uit het onderwijs met interactieve touch displays! Haal meer uit het onderwijs met interactieve touch displays! Met de all in one CTOUCH displays biedt Sahara Interactive u de opvolger het oude digitale schoolbord en de noodzakelijke randapparatuur. De

Nadere informatie

Architectuurredeneermodel Afgewogen keuzes maken

Architectuurredeneermodel Afgewogen keuzes maken Architectuurredeneermodel Afgewogen keuzes maken Robert Deckers SASG okt 2012 v3 Architectuur: technologie in perspectief Klantbehoefte Toepassing Systeem T 2 Vele wegen die naar ergens leiden Bewuste

Nadere informatie

PGGM. Inkomensverzorger voor de sector zorg en welzijn. Hans de Harde Sr. ICT Architect Fysieke Infrastructuur

PGGM. Inkomensverzorger voor de sector zorg en welzijn. Hans de Harde Sr. ICT Architect Fysieke Infrastructuur PGGM Inkomensverzorger voor de sector zorg en welzijn Hans de Harde Sr. ICT Architect Fysieke Infrastructuur Wat doet PGGM Uitvoeringsorganisatie collectieve pensioenregelingen voor de sector zorg en welzijn

Nadere informatie

Windows Phone 8X HTC. De enige Windows Phone met Beats Audio

Windows Phone 8X HTC. De enige Windows Phone met Beats Audio De enige Windows Phone met Beats Audio Windows Phone 8S HTC Een nieuwe, meer persoonlijke user interface Design DNA van HTC HTC Proprietary and Confidential De enige Windows Phone met Beats Audio Iconisch

Nadere informatie

Gebruikershandleiding E-Zorg Remote Access op Android.

Gebruikershandleiding E-Zorg Remote Access op Android. Inhoud 1) Inleiding Pagina 2 2) Het token Pagina 2 3) Junos Pulse installeren en configureren Pagina 3 4) Een verbinding maken met Junos Pulse Pagina 4 5) Een werkstation op afstand overnemen Pagina 6

Nadere informatie

Meer mogelijkheden voor mobiele medewerkers met secure app delivery

Meer mogelijkheden voor mobiele medewerkers met secure app delivery Meer mogelijkheden voor mobiele medewerkers met secure app delivery Werken met Windows-applicaties op alle mogelijke devices, met volledige security. Om gemakkelijk en productief te werken, willen veel

Nadere informatie

Visie & Strategie. Aad van Schetsen. Vice President & General Manager Uniface Delft, 18 November 2009

Visie & Strategie. Aad van Schetsen. Vice President & General Manager Uniface Delft, 18 November 2009 Visie & Strategie Aad van Schetsen Vice President & General Manager Uniface Delft, 18 November 2009 Agenda Visie Strategie Technologie Kennis Marketing Organisatie Uniface in de Crisis Investeringen worden

Nadere informatie

Opdrachtformulering (pagina 3 van 7)

Opdrachtformulering (pagina 3 van 7) Afstudeerovereenkomst van Tim Wils Bijlage 1 Opdrachtformulering (pagina 3 van 7) Dit project betreft een eigen framework (soort API) waarmee relatief gemakkelijk en in korte tijd eindproducten opgezet

Nadere informatie

Software Processen. Ian Sommerville 2004 Software Engineering, 7th edition. Chapter 4 Slide 1. Het software proces

Software Processen. Ian Sommerville 2004 Software Engineering, 7th edition. Chapter 4 Slide 1. Het software proces Software Processen Ian Sommerville 2004 Software Engineering, 7th edition. Chapter 4 Slide 1 Het software proces Een gestructureerd set van activiteiten nodig om een software systeem te ontwikkelen Specificatie;

Nadere informatie

Software Test Document

Software Test Document Software Test Document PEN: Paper Exchange Network Software Engineering groep 1 (se1-1415) Academiejaar 2014-2015 Jens Nevens - Sander Lenaerts - Nassim Versbraegen Jo De Neve - Jasper Bevernage Versie

Nadere informatie

Welkom bij IT-Workz. Etten-Leur, 16 november 2010. Altijd en overal werken en leren. Applicatie en Desktop Delivery met Quest vworkspace

Welkom bij IT-Workz. Etten-Leur, 16 november 2010. Altijd en overal werken en leren. Applicatie en Desktop Delivery met Quest vworkspace Welkom bij IT-Workz Altijd en overal werken en leren Applicatie en Desktop Delivery met Quest vworkspace Etten-Leur, 16 november 2010 IT-Workz is de verzelfstandigde Dienst ICT van het ROC West-Brabant.

Nadere informatie

DOCENTENHANDLEIDING JET-NET WEBCAST

DOCENTENHANDLEIDING JET-NET WEBCAST DOCENTENHANDLEIDING JET-NET WEBCAST Inhoudsopgave Inloggen... 3 Layout... 5 Interactie... 6 Benodigdheden... 8 Praktische tips... 8 Bijlage I : HELP... 9 2 Inloggen Om deel te nemen aan de webcast, moet

Nadere informatie

Release notes Argo 7. Interactieve LMS interface. Nieuwe interface voor lesmodules

Release notes Argo 7. Interactieve LMS interface. Nieuwe interface voor lesmodules Release notes Argo 7 Argo 7 heeft een interactief web design. Het is optimaal afgestemd op de grote diversiteit aan computerbeeldschermen, van grootbeeld desktops en notebooks tot tablets en smart phones.

Nadere informatie

voor de realisatie van field proven, robuuste, precieze en economische 3D visie systemen voor robot picking en 3D vorm inspectie

voor de realisatie van field proven, robuuste, precieze en economische 3D visie systemen voor robot picking en 3D vorm inspectie Do s en dont s voor de realisatie van field proven, robuuste, precieze en economische 3D visie systemen voor robot picking en 3D vorm inspectie Do s en dont s voor de realisatie van field proven, robuuste,

Nadere informatie

Software Test Plan. Yannick Verschueren

Software Test Plan. Yannick Verschueren Software Test Plan Yannick Verschueren Maart 2015 Document geschiedenis Versie Datum Auteur/co-auteur Beschrijving 1 November 2014 Yannick Verschueren Eerste versie 2 December 2014 Yannick Verschueren

Nadere informatie

Cloud Computing. Definitie. Cloud Computing

Cloud Computing. Definitie. Cloud Computing Cloud Computing Definitie In de recente literatuur rond Cloud Computing zijn enorm veel definities te vinden die het begrip allemaal op een verschillende manier omschrijven. Door deze diversiteit zijn

Nadere informatie

Informaticabeheer Generation Development Technical Paper (Developing the next generation for you)

Informaticabeheer Generation Development Technical Paper (Developing the next generation for you) Informaticabeheer Generation Development Technical Paper (Developing the next generation for you) Auteurs: Mattijs Eggermont, Brent Alleweireldt, Cedric Cornelis, Nick Cornelis, Jasper Deblieck en Jordy

Nadere informatie

23 Deurintercom systeem www.paxton-benelux.com +31 76 3333 999 info@paxton-benelux.com

23 Deurintercom systeem www.paxton-benelux.com +31 76 3333 999 info@paxton-benelux.com 23 Paxton 24, het slimme en simpele deurintercom systeem is ontworpen om het meest simpelste deurintercom systeem te zijn. Het systeem is snel en eenvoudig te monteren en maakt gebruik van slechts één

Nadere informatie

Software Test Plan. Yannick Verschueren

Software Test Plan. Yannick Verschueren Software Test Plan Yannick Verschueren November 2014 Document geschiedenis Versie Datum Auteur/co-auteur Beschrijving 1 November 2014 Yannick Verschueren Eerste versie 1 Inhoudstafel 1 Introductie 3 1.1

Nadere informatie

Gebruikershandleiding E-Zorg Remote Access op Android.

Gebruikershandleiding E-Zorg Remote Access op Android. Inhoud 1) Inleiding Pagina 2 2) Het token Pagina 2 3) Junos Pulse installeren en configureren Pagina 3 4) Een verbinding maken met Junos Pulse Pagina 4 5) Een werkstation op afstand overnemen Pagina 6

Nadere informatie

De mogelijkheden van Adobe Acrobat 8 voor het maken van toegankelijke PDF documenten

De mogelijkheden van Adobe Acrobat 8 voor het maken van toegankelijke PDF documenten De mogelijkheden van Adobe Acrobat 8 voor het maken van toegankelijke PDF documenten Colin van Oosterhout Business Development Manager Acrobat Agenda Introductie op Adobe Achtergronden van PDF Drijfveren

Nadere informatie

HCS Audiovisueel. Oplossingen voor elk klaslokaal. Projectieborden / beamer oplossingen pagina 9-12

HCS Audiovisueel. Oplossingen voor elk klaslokaal. Projectieborden / beamer oplossingen pagina 9-12 HCS Audiovisueel Onze oplossingen/concepten HCS Audiovisueel Pagina 3 Oplossingen voor elk klaslokaal Touchscreens pagina 2-5 Pagina 2 HCS Audiovisueel Touchscreens Pagina 2 Onze oplossingen/concepten

Nadere informatie

SURFACE BESCHRIJVING. Wat is het? Voor wie is het? Hoe werkt het? De Surface in het onderwijs

SURFACE BESCHRIJVING. Wat is het? Voor wie is het? Hoe werkt het? De Surface in het onderwijs BESCHRIJVING SURFACE Wat is het? De Surface is een liggend 30 inch beeldscherm op een tafel waaraan meerdere kinderen tegelijk kunnen werken. Zij bedienen de Surface met hun handen. Het apparaat kan 52

Nadere informatie

Technologie. Bluetooth gebruiken

Technologie. Bluetooth gebruiken Bluetooth is communicatietechnologie die het mogelijk maakt data te versturen en te ontvangen zonder leidingen of kabels. Met de Bluetooth features kun je een draadloze verbinding maken tussen je NXT en

Nadere informatie

Mitel User Group. Mitel-licentiestructuur. Jan Jansen. Account Director april 2015

Mitel User Group. Mitel-licentiestructuur. Jan Jansen. Account Director april 2015 Mitel User Group Mitel-licentiestructuur Jan Jansen Account Director april 2015 De concrete vraag Kan iemand van Mitel de licentiestructuur uitleggen? 2 Agenda Waarom licenties Basis Mitel-licentiestructuur

Nadere informatie

Het SEESCOA project; jouw user interface, altijd en overal

Het SEESCOA project; jouw user interface, altijd en overal Het SEESCOA project; jouw user interface, altijd en overal Kris Luyten Karin coninx 17 januari 2002 Samenvatting De informatica kende een ware revolutie voordat men tot de desktop PC gekomen is. 20 jaar

Nadere informatie

Net2 Entry. Het simpelste IP deurintercom systeem beschikbaar

Net2 Entry. Het simpelste IP deurintercom systeem beschikbaar Net2 Entry Het simpelste IP deurintercom systeem beschikbaar Net2 Entry Nieuwe generatie intercom met verbeterde functionaliteiten voor veelzijdige beveiliging en gebouwbeheer Net2 Entry is het meest gebruiksvriendelijke

Nadere informatie

Technisch Ontwerp W e b s i t e W O S I

Technisch Ontwerp W e b s i t e W O S I Technisch Ontwerp W e b s i t e W O S I WOSI Ruud Jungbacker en Michael de Vries - Technisch ontwerp Website Document historie Versie(s) Versie Datum Status Omschrijving / wijzigingen 0.1 20 nov 2008 Concept

Nadere informatie

Nederlandse samenvatting (Dutch summary)

Nederlandse samenvatting (Dutch summary) Nederlandse samenvatting (Dutch summary) Ditproefschriftpresenteerteen raamwerk voorhetontwikkelenvanparallellestreaming applicaties voor heterogene architecturen met meerdere rekeneenheden op een chip.

Nadere informatie

Zoeken, Sturen en Bewegen. AR.Drone Fotografie. semi-autonome portretfoto s met behulp van gezichtsherkenning

Zoeken, Sturen en Bewegen. AR.Drone Fotografie. semi-autonome portretfoto s met behulp van gezichtsherkenning Zoeken, Sturen en Bewegen AR.Drone Fotografie semi-autonome portretfoto s met behulp van gezichtsherkenning Tim Leunissen (10191828) Ilse van der Linden (10093990) Tomas Bijkerk (10002145) Alexander van

Nadere informatie

1.Noem de vijf categorieën waarin programmeertalen kunnen worden ingedeeld en geef van elke categorie één voorbeeld.

1.Noem de vijf categorieën waarin programmeertalen kunnen worden ingedeeld en geef van elke categorie één voorbeeld. Module 4 programmeren 1.Noem de vijf categorieën waarin programmeertalen kunnen worden ingedeeld en geef van elke categorie één voorbeeld. Machinecode Assembleertalen: assembly Hogere programmeertalen:

Nadere informatie

Module 1: Wat is een Raspberry Pi?

Module 1: Wat is een Raspberry Pi? Module 1: Wat is een Raspberry Pi? Inhoudsopgave Module 1: Wat is een Raspberry Pi?...1 Wat is een Raspberry Pi?...2 Wat is er zo bijzonder aan de Raspberry Pi?...2 Wie zitten er achter de Raspberry Pi...2

Nadere informatie

Uitpakken. Inleidingen

Uitpakken. Inleidingen 2 Gefeliciteerd met de aanschaf van dit fraai ontworpen notebook. Dit gloednieuwe, voortreffelijke product verzekert u van een aangename en professionele gebruikerservaring. Wij zijn er trots op dat wij

Nadere informatie

Portals & Open Source

Portals & Open Source Portals & Open Source OGh Jaarcongres 2003 Zeist, 7 october R.V.L.P. Schaaf Agenda Introductie Begrippenkader en standaards Open Source portals Onder de loep: Imbrium Praktijk case Open Source in uw organisatie?

Nadere informatie

Samenvatting Hoofdstuk1

Samenvatting Hoofdstuk1 Samenvatting Hoofdstuk1 Software kun je sorteren in allerlei manieren zoals: - De geschreven taal van de software of de taak waarvoor de software geschreven is. - Het platform waarop de software moet draaien.

Nadere informatie

Grafisch ontwerp. Referenties. https://developers.google.com/webmasters/mobile-sites/ http://www.bluetrainmobile.com/mobile-showcase

Grafisch ontwerp. Referenties. https://developers.google.com/webmasters/mobile-sites/ http://www.bluetrainmobile.com/mobile-showcase Mobiel Datanose Op dit moment is mobiel datanose niet goed gedaan; je krijgt gewoon de site te zien zoals je het te zien krijgt op pc's of laptops. Maar vaak heb je het probleem dat je op je mobiel moet

Nadere informatie

Uitgebreid voorstel Masterproef Informatica. Titel van het project: Rolnummerherkenning van op een kraan

Uitgebreid voorstel Masterproef Informatica. Titel van het project: Rolnummerherkenning van op een kraan HoGent Uitgebreid voorstel Masterproef Informatica Titel van het project: Rolnummerherkenning van op een kraan Datum: 17/11/12 Naam student: Cédric Verstraeten Interne promotor: Tim De Pauw In samenwerking

Nadere informatie

Lt. Bruno de Ras Academiejaar 2010-2011. Hardware Study

Lt. Bruno de Ras Academiejaar 2010-2011. Hardware Study Koninklijke Militaire School Leerling-Officier STEYLAERTS 150e Promotie SSMW 1 Bachelor Lt. Bruno de Ras Academiejaar 2010-2011 Hardware Study de kaartlezer Met Open Office 1 2 Contents 1 Inleiding p.

Nadere informatie

Card sorting Sitemap Use case. Wireframes Schermontwerpen Stijlgids. Niet in les gedaan! Via je einddocument. Verkennen. Genereren.

Card sorting Sitemap Use case. Wireframes Schermontwerpen Stijlgids. Niet in les gedaan! Via je einddocument. Verkennen. Genereren. Hoorcollege 4 Verkennen Genereren Evalueren Communiceren Card sorting Sitemap Use case Wireframes Schermontwerpen Stijlgids Niet in les gedaan! Via je einddocument Schermontwerpen Pauze Stijlgids Feedback

Nadere informatie

Introduceert KASPERSKY ENDPOINT SECURITY FOR BUSINESS

Introduceert KASPERSKY ENDPOINT SECURITY FOR BUSINESS Introduceert KASPERSKY ENDPOINT SECURITY FOR BUSINESS 1 Business strategieën en de impact voor de IT FLEXIBILITEIT Snel handelen met wendbaarheid en flexibiliteit Voor 66% van de organisaties staat flexibiliteit

Nadere informatie

iprova Suite Systeemeisen client

iprova Suite Systeemeisen client iprova Suite Systeemeisen client Hardware Aanbevolen configuratie: Pentium IV 1 Ghz of beter, min. 512 MB RAM, min. 200 MB vrije schijfruimte In alle gevallen moet worden voldaan aan de minimum systeemeisen

Nadere informatie

21 x 16 / 0,4 m 38 x 28 / 0,3 m (optioneel verkrijgbaar) 11 x 8,5 / 1,2 m (optioneel verkrijgbaar)

21 x 16 / 0,4 m 38 x 28 / 0,3 m (optioneel verkrijgbaar) 11 x 8,5 / 1,2 m (optioneel verkrijgbaar) Warmtebeeldcamera PCE-TC 9 warmtebeeldcamera met autofocus / 384 x 288 pixels / IP 50 behuizing / realtime overdracht van de warmtebeeldcamera naar de PC / digitale camera met 3.0 megapixels / vídeo-uitgang

Nadere informatie

Software Test Plan. PEN: Paper Exchange Network Software Engineering groep 1 (se1-1415) Academiejaar 2014-2015

Software Test Plan. PEN: Paper Exchange Network Software Engineering groep 1 (se1-1415) Academiejaar 2014-2015 Software Test Plan PEN: Paper Exchange Network Software Engineering groep 1 (se1-1415) Academiejaar 2014-2015 Jens Nevens - Sander Lenaerts - Nassim Versbraegen Jo De Neve - Jasper Bevernage Versie 1 Versie

Nadere informatie

Installatie van de software voor de Spyder 3 Elite 3.0

Installatie van de software voor de Spyder 3 Elite 3.0 Installatie van de software voor de Spyder 3 Elite 3.0 Om de software van de Spyder te kunnen installeren zijn er onderstaande minimum systeemvereisten van uw hardware vereist: ) Windows 2000, XP 32/64,

Nadere informatie

Het besturingssysteem of operating system, vaak afgekort tot OS is verantwoordelijk voor de communicatie van de software met de hardware.

Het besturingssysteem of operating system, vaak afgekort tot OS is verantwoordelijk voor de communicatie van de software met de hardware. Het besturingssysteem of operating system, vaak afgekort tot OS is verantwoordelijk voor de communicatie van de software met de hardware. Het vormt een schil tussen de applicatiesoftware en de hardware

Nadere informatie

Your view on business On your favorite device

Your view on business On your favorite device ANY2INFO OVER ONS Your view on business On your favorite device Any2info is een ICT-onderneming gespecialiseerd in de ontwikkeling van standaard software waarmee mobiele bedrijfsapps kunnen worden gebouwd

Nadere informatie