Influenza Een literatuurstudie (met voorliefde voor de geriatrische zorg) Bram Hengeveld Saxion Hogescholen Enschede

Maat: px
Weergave met pagina beginnen:

Download "Influenza Een literatuurstudie (met voorliefde voor de geriatrische zorg) Bram Hengeveld Saxion Hogescholen Enschede 80058@student.saxion."

Transcriptie

1 Influenza Eenliteratuurstudie (metvoorliefdevoordegeriatrischezorg) BramHengeveld SaxionHogescholenEnschede

2 2 BramHengeveld,juni2009

3 Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 3 Inhoudsopgave Inleiding...5 Zoekmethode...7 Samenvattingen Influenza Kernvragen Beschrijvingvanhetziektebeeld Virussen Oorzaakvaninfluenza:hetinfluenzavirus Afweerenimmuniteit Epidemiologie Preventie&behandeling Kernvragen Nonfarmacologischemaatregelen Vaccins Behandelingvaninfluenza Alternatieveinterventies Organisatie&ethiek Kernvragen Overheidsbeleid Verbeteringvandeinfluenzavaccinatiegraadondermedewerkersvaneen zorginstelling Ethiek...37 Afsluitend...40 Bronnen...41 Literatuur...41 Internetpagina soverinfluenzaendeinfluenzavaccinatie:...46 Afbeeldingen...46

4 4 BramHengeveld,oktober2009

5 Inleiding In de jaren negentig van de vorige eeuw slaagden wetenschappers erin om een belangrijkeoorzaakvaneenmassalesterfteonderdewereldbevolkingrond1918 tebepalen.eendrietalveranderdegenenzorgdenervoordatdemenselijkelong ineensveeltoegankelijkerwerdvoorwateenkillerbleektezijn.miljoenenmensen overleden. In die tijd was over de oorzaak van de sterfte echter nog vrij weinig bekend,alhoewelhetaanwezigeziektebeeldalzeerlangbekendwas.pasin1933 werd de oorzaak van de massasterfte voor het eerst geïsoleerd in varkens: het influenzavirus.in1937volgendedeisolatievanhethumaneinfluenzavirus.ophet momentvanschrijvenzijnregeringenoverdegehelewereldbijzonderbedachtop de ontwikkeling van een soortgelijk, pandemisch virus als in 1918: Nieuwe InfluenzaA/H1N1 Influenza,wellichtbeterbekendals degriep,iseencomplexprobleem,datzich manifesteert op verschillende vlakken. Want zowel op het wetenschappelijk methodologisch, epidemiologisch, medisch, (medisch)ethisch, sociaal als ook het organisatorischvlakstaatdenederlandsemaatschappijjaarlijkssteevastvooreen uitdaging:deepidemievaninfluenza.veelvandieproblemenspelenzich achter deschermen af.wantalhoewelinfluenzakanzorgenvoorveelziekteensterfte,is hetvooreengrotegroepmensendoorgaansgeenziektedieeenhogemortaliteit of morbiditeit kent. Voor een aantal groepen echter, ligt dat anders. Onder bijvoorbeeld de oudere burger en met name de kwetsbare (frail) ouderen zijn ernstigegevolgenvaninfluenzageen vervanhetbedshow.indergelijkekringen isdeinfluenzadiscussieeenrealiteitdiebijzonderveelpersonen,waarondereen grotegroepzorgverleners,aangaat. In dit literatuurverslag is een samenvatting te vinden van een aantal belangrijke aspecten van influenza en het influenzavirus. Om een mening of zelfs organisatorische beslissingen binnen een instelling te kunnen baseren op deugdelijke informatie, is het belangrijk om daar een overzicht van te vinden. Ondergetekendehooptdaarintevoorzienmetditdocument.Dezeliteratuurstudie behandelt de verschillende aspecten van het vraagstuk van influenza en de influenzavaccinatie in de (geriatrische) gezondheidszorg in verschillende hoofdstukken die een aansluitend geheel vormen, maar ook afzonderlijk gelezen kunnenworden. BramHengeveld, Enschede,juni2009 Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 5

6 6 BramHengeveld,oktober2009

7 Zoekmethode de databanken van Saxion worden geraadpleegd, of de abstract duidde op afwezigheidvanrelevanteinformatie),diedoordeauteurwerdengelezeneneen basis vormden voor verdere studie. Publicaties werden doorgelezen op verwijzingenenwaarmogelijkenrelevantwerdendezegeraadpleegd.(n=55) Terverfijningvandefocusopdegeriatrischezorgwerdeentweedezoekopdracht uitgevoerd,maardezeleverdegeennieuwepublicatiesop: PUBMED en de Cochrane Database of Systematic reviews werden doorzocht op relevantepublicatiesm.b.t.influenza,influenzavaccinatieeninfluenzavaccinatiebij zorgverlenersenouderen.eeneerste(indicatieve)pubmedzoekopdrachtmetde termen influenza,human {MeSHterms]leverdeeenoverweldigendehoeveelheid van hits op, waarvan 2029 reviews. Vanwege de jaarlijkse aandacht voor influenzawerdbeslotenompubmedtedoorzoekenoppublicatiesvanhetlaatste jaar en alleen Randomized Controlled Trials (RCT), behandelings richtlijnen en systematische reviews (in het Engels en Nederland) op te laten nemen, die verwijzingen boden naar links met online fulltext publicaties. Ook werden de begrippen pandemic en H5N1 uitgesloten: ("influenza, human"[mesh Terms] AND ("2008/01/01"[PDAT] : "2009/05/25"[PDAT])) NOT H5N1[All Fields] AND ("loattrfull text"[sb] AND (English[lang] OR Dutch[lang]) AND (Meta- Analysis[ptyp] OR Practice Guideline[ptyp] OR Randomized Controlled Trial[ptyp] OR Review[ptyp])) (de hier getoonde zoekopdracht is een herhaling ten tijde van de afronding van dezeliteratuurstudie,deeerstezoekopdracht(31dec.2008)leverde96hitsop)de getoonde zoekopdracht leverde 114 reviews op, waarvan op basis van titel en abstract 54 publicaties werden uitgesloten i.v.m. irrelevante onderwerpen. (aandachtvooréénras,onderzoeknaarpreventievemethodenvoorvliegvelden, experimentele vaccin designs, logistiek van vaccinproductie, ander virus dan influenza,geenabstractoflinknaarfulltext,fulltextinanderetaaldanengelsof Nederlands,alleenonderzoekopkinderen,onderzoeknaarevolutievanhetvirus, pandemische influenza, wiskundige modellen, aviaire influenza, gebruik van antibiotica,onderzoeknaarzangers,focusopééngeografischeregio)uiteindelijk bleven46raadpleegbarepublicatiesover(nietallefulltextpublicatieskondenvia ("2008/01/01"[PDAT] : "3000"[PDAT]) AND (("influenza, human"[mesh Terms] AND "aged"[mesh Terms])) AND (Meta- Analysis[ptyp] OR Practice Guideline[ptyp] OR Randomized Controlled Trial[ptyp] OR Review[ptyp]) De Cochrane Database of Systematic Reviews werd doorzocht m.b.v. de zoekopdracht influenza en influenza en prevention (indeabstracts),welkeresp 31 en 22 hits opleverde. Exclusie van publicatie gebeurde op basis van het onderwerpkinderen(children).naexclusiebleven15publicatiesover,diedoorde auteur werden gelezen. Waar relevant en toegankelijk werden referenties ook geraadpleegd ter verduidelijking van de gegevens. Op basis van de Cochrane Review werd tevens 1 publicatie uit de PubMed zoekopdracht uitgesloten, vanwegeuitsluitingindecochranemetaanalyse. Inoktober2009iseréénnieuwartikeltoegevoegd(Opstelten,Rimmelzwaan,van Essen en Bijlsma, 2009) over de werking van vaccinatie bij personen met een verminderdeafweer. Ook werd materiaal in eigen bezit gebruikt (voor het eerste hoofdstuk) en zijn enkelepublicatiesverkregenviaderden.(eenadviesvandegezondheidsraad,een publicatieoverdeeffectenvaneenvaccinatiecampagneeneenaantalreviewsmet een duidelijke opiniëring en provaccinatie betoog) Deze leverden echter geen nieuwe referenties op. Tevens werd informatie aangaande influenza op de websitesvanhetrijksinstituutvoorvolksgezondheidenmilieu 1 (RIVM),European Influenza Surveillance Scheme (EISS), de World Health Organisation 2 (WHO) en Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 7

8 Centers for Disease Control and Prevention 3 (CDC) geraadpleegd. In September 2009ishetEISSovergegaaninhetEuropeanInfluenzaSurveillanceNetwork 4 (EISN) Opbasisvandeeerstezoekopdrachten(inCochraneenPubMed),hetbestuderen van de gevonden literatuur en overleggen met het management van de zorginstelling waar ik stage loop werden drie aandachtsgebieden vastgesteld: 1. Influenza (het ziektebeeld, oorzaak, epidemiologie); 2. Preventie en behandeling (nonfarmacologischenfarmacologisch);3.organisatieenethiek(overheidsbeleid, instellingsbeleid en ethische aspecten van influenza en vaccinatie voor zorgverleners). Per aandachtsgebied zijn kernvragen bepaald (zie begin van de verschillendehoofdstukken),waarnadezewordenbeantwoordindeverschillende paragrafen. Een groot deel van de gebruikte literatuur werd gevonden via referenties van artikelen en additionele kleine zoekacties, ter verduidelijking van een bepaald onderwerp. Uiteindelijk zijn de bevindingen van 148 publicaties opgenomen in dit verslag, van uiteenlopend bewijsniveau. (A t/m D) Methodologische tekortkomingen van de verschillende studies worden in het verslaggenoemd. Discussie Dezezoekmethodekentduidelijkebeperkingen,maarleverdeeengoedestartvoor eenstudienaarinfluenza.degebruikte sneeuwbalmethode 5 heeftveelleeswerk gegenereerd, waaronder op enkele voor de auteur vrij onbekende gebieden, hetgeen mogelijk implicaties heeft voor de uiteindelijke conclusies. Een andere beperking werd gevormd door de beperkte toegang tot online publicaties via Saxion Hogescholen. De databanken van ScienceDirect, Springerlink en Cochrane kennen (beperkte) toegangsmogelijkheden. De hoeveelheid publicaties op het gebiedvaninfluenzaisimmens,maardepublicatiesuithetlaatstejaar(pubmed) en de Cochrane library gaven eenduidelijk beeld en terugkerende vraagstukken, waardoor ik meen een vrij duidelijk inzicht te hebben gekregen van beschikbaar onderzoeksmateriaal, binnen de grenzen van de mij beschikbare tijd en kennis. Naastdehuidigematevanbewijsiserookruimtevoorkritischekanttekeningenbij datbewijseneenschetsvaneenaantalgevondentegenstellingen Driesen, F. (1992). Het gebruik van vakliteratuur. Dwingeloo: Kavanah 8 BramHengeveld,oktober2009

9 Samenvattingen 1. Influenza InfluenzaiseenrespiratoireinfectieziektediewordtveroorzaaktdoordeA&Btypen van het influenzavirus, waarbij met name influenza A verantwoordelijk is voor morbiditeitenmortaliteitt.g.v.influenza.hetziektebeeldwordtgekenmerktdoorsnel optredendekoorts,rillingen,hoestenenbedlegerigheid.algeheelherstelkantot2a3 weken duren, de koorts zakt meestal na 35 dagen. Na deze periode is er immuniteit opgetreden,diedoorgaansvankorteduuris,vanwegemutatievanhetinfluenzavirus. Influenza komt in gematigde regio s van de wereld epidemisch voor in de winter en veroorzaaktdangroteziektelast,sterfteeneconomischebelasting.innederlandisde indicidentie van influenza sinds 1979 trendmatig gedaald. Per jaar bezoeken ong personen de huisarts i.v.m. influenza. Incidentie en prevalentiecijfers kunnen echter een vertekend beeld geven vanwege de veelheid aan pathogenen die een InfluenzaAchtig Ziektebeeld (IAZ) veroorzaken. Voor gezonde volwassenen is influenza doorgaanseenziektedienietgepaardgaatmetverhoogdecomorbiditeitofmortaliteit, maarvoormetnameouderen(enpersonenmeteenchronischeziektezoalsdiabetes, hartafwijkingen,nierpatiëntenenimmunogesuppresseerdepersonen)geldtditwel:90% van de sterfte t.g.v. influenza komt voor in de groep van 65+jaar. Een uitzondering hieropwordtgevormddoordemogelijkheidvaneenzgn.pandemisch,sterkgemuteerd influenzaavirus.gedurendedepandemievan1918(de Spaansegriep)wasdeziekte met name gevaarlijk voor (doorgaans gezonde) volwassen. In de afgelopen 100 jaar heeftdewerelddrieinfluenzapandemieëngekend,waarbijsprakewasvan(zeer)hoge sterfte. Wereldwijd is er een grote alertheid op de verspreiding en gevolgen van een nieuw pandemisch virus, vanwege de enorme maatschappelijke, persoonlijke en financiëlegevolgendieeenpandemiezoukunnenhebben. 2. Preventie&Behandeling Bij de preventie en behandeling zijn er op basis van de literatuur een aantal aandachtsgebiedentebepalen:algemenepreventievemaatregelen:goedehand en hoesthygiëne, goede screening op incidentie van influenza. Ten tijde van influenzauitbraken (een plotselinge uitbraak van influenza op één, bijv. een verpleegafdeling) kan er gebruik worden gemaakt van handschoenen, schorten en professionelemaskersenclusterverpleging.vaccinatie:vaccinatieiseenvoorgezonde volwassenen effectief middel om sterfte en morbiditeit te voorkomen. Voor ouderen lijkt dit effect ook aanwezig (met name algehele sterfte), al is de mate van effect onderwerp van wetenschappelijke discussie. Vaccinatie van risicogroepen, gezonden volwassenen en ouderen is kosteneffectief en in enkele gevallen kostenbesparend. Vaccins zijn er in verschillende soorten, maar in Nederland is het (intramusculair geïnjecteerde) trivalente geïnactiveerde vaccin het enige gebruikte vaccin. Ook is hier het meeste onderzoek naar verricht. Er blijft echter behoefte aan meer en beter onderzoek, omdat onderzoek naar influenza te lijden heeft onder methodologische problemenbijonderzoeknaarheteffectvanvaccinatie.behandelingvaninfluenza. Eenmaalontstaneinfluenzakanbehandeldwordenmettweetypenantiviralemiddelen (neuraminidaseinhibitoren en M2inhibitoren), waarvan er hoofdzakelijk één een aanbevolen gebruik kent: oseltamivir (Tamiflu ). M2inhibitoren (amantadine en rimantadine) kennen een toenemende mate van onwerkzaamheid vanwege resistentievormingvaninfluenzavirussentegenamantadineenrimantadine(influenzaa H3N2:ong.99%).OokzijnM2inhibitorennietbruikbaartegeninfluenzaB.Oseltamiviris een neuraminidaseinhibitor en voorkomt het vrijkomen van reeds gevormde nieuwe virusdeeltjes in het lichaam. Er is een significante, zij het beperkte bekorting van de ziektelast,waardoorantiviralemiddelenmetnamegeschiktzijnbijdebehandelingvan uitbraken en profylaxe bij gezonde personen die niet gevaccineerd zijn of bij wie het vaccin niet of niet goed werkt (door mismatch of verminderde immunogeniciteit) Oseltamivir kent ook een (toenemende) mate van onwerkzaamheid vanwege resistentievorming. 3. Organisatieenethiek OuderenenrisicogroepenkomeninNederlandviahetRVP(RijksVaccinatieProgramma) in aanmerking voor een jaarlijkse influenzavaccinatie. Van de groep ouderen laat zich een groot deel vaccineren (ongeveer 75%). Alhoewel aanbevolen door de GezondheidsraadisvaccinatievanzorgverlenersgeenonderdeelvanhetRVP,maarzijn zorgorganisatieshierzelfverantwoordelijkvoor.devaccinatiegraadonderzorgverleners is,enkeleuitzonderingendaargelaten,doorgaanslaag.succesvollecampagneshebben aangetoond dat een verhoging van de vaccinatiegraad onder zorgverleners instellingsbreedverbeterdkanworden.ditvergteenorganisatiediehethelejaardoor actief is, maar piekt vlak voor en tijdens het influenzaseizoen. On site vaccinatie, duidelijk door leidinggevenden uitgedragen doelstellingen en postercampagnes zijn effectief in het verhogen van de vaccinatiegraad, evenals herinneringssystemen om personenteattenderenophettoegediendkrijgenvaneenvaccin.eenaantalbarrières worden gevormd door mythen over het vaccin, het virus en de ziekte, die door voorlichtingontkrachtkunnenworden.bijdebesluitvormingrondomdeorganisatievan eenvaccinatiecampagnezijnereenaantalethischevraagstukkendieeenrolspelenen aandachtbehoevenbinnendeorganisatie.dezevraagstukkenhebbentemakenmetde professioneleidentiteitenzelfbeschikkingvanzorgverlenendpersoneel:watkanenmag menvaneenzorgverlenerverwachten? Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 9

10 10 BramHengeveld,oktober2009

11 Influenza In dit hoofdstuk staan de ziekte influenza en de veroorzaker ervan centraal. Inzicht in de kwestie rond de influenza vaccinatie in de (geriatrische) gezondheidszorg vereist enige basiskennis van het ziektebeeld en de eigenschappen van de oorzaak. 1.1 Kernvragen 1. Watishetziektebeeldenverloopvaninfluenza? 2. Watisdeoorzaakvaninfluenza? 3. Watzijndeepidemiologischegegevensomtrentinfluenza? 1.2 Beschrijving van het ziektebeeld Influenza( griep )iseeninfectueuzeaandoeningvande(bovenste)luchtwegen.de belangrijkste symptomen die wijzen op de aanwezigheid van influenza: koorts (pyrus)enrillingent.g.v.dekoortsenzweten.eenzerekeel,spierpijn(myalgie), botpijn (arthralgie), hoesten, moeheid en hoofdpijn zijn andere symptomen die wijzenopinfluenza,zeihetmetminderovertuiging(ebell,white&causal,2004). De koorts kan in een aantal uren oplopen tot 39 graden en hoger en zakt dan doorgaansbinnen3 5dagenweer.Algeheelherstelkantot3wekenopzichlaten wachten. In ongeveer de helft van de gevallen verloopt het ziekteproces subklinisch. Met name wanneer zich secundaire klachten (veroorzaakt door influenza) voordoen, wordt een arts ingeschakeld. De meest voorkomende complicaties zijn otitis media (middenooronsteking), longontsteking (pneumonie), acutebronchitis,myocarditisenprimaireviralepneumonie.(landelijkecoördinatie Infectieziekten, 2008) Met name risicogroepen zijn gevoelig voor dergelijke complicaties.hetziektebeeldwordtvaakverwardmeteenzwareverkoudheid,of 'buikgriep' (gastroenteritis). In het Coëlho Zakwoordenboek der geneeskunde (Deen,2003p.424)wordtinfluenzaalsvolgtomschreven: [...]Acute, vaak epi of pandemisch verlopende, sterk besmettelijke infectieziekte,hoofdzakelijkegekenmerktdoorbuikpijnenbraken(vooral bij kinderen), ontsteking (catarre) van het slijmvlies van de bovenste luchtwegen (hoesten!), hoofdpijn, slapeloosheid, koorts, spierpijn, lichtschuwheidenpijnachterdeogen DeWorldHealthOrganisationheeftinfluenzageclassificeerdinhoofdstuk10van deicd10,onder diseasesoftherespiratorysystem,j08j11.(who,2007) 1.3 Virussen Influenza wordt veroorzaakt door een virus, waarover in deze paragraaf ter volledigheid enigszins wordt uitgewijd. In hun zuiverste vorm zijn virussen enkel pakketjesgenetischeinformatie(rnaofdna),dieineeneiwitkapsel(capside)zijn ingepakt.rnaofdna+capsidevormenhet virion.(bijsommigevirussenzoals het virus dat influenza veroorzaaktis het genetische materiaal gesegmenteerd aanwezig, i.p.v. in één lange keten) Van een cel (zoals bij een bacterie) is geen sprake.welkanhetvirioneen mantel (coatingofenvelope)vanlipidenhebben. Dezewordenvoorhetvirusdoordegastcelgevormd(natuurlijkin opdrachtvan hetvirus).ookdientopgemerkttewordendathetvirusenhetvirion(virusdeeltje) verschillendzijn:methetvirionwordthetsysteembedoelddateencelinfecteert. Zodra dit gebeurt is spreekt men van een virus. (Regenmortel, 2000) Een virus heeftnl.eigenschappendiepasnainfectienaarbuitenkomen.ookdienteenvirus te worden gezien als een geheel van de verschillende virions, die alle een niet geheel identieke kopie van elkaar vormen; het is een dynamisch systeem dat constantininteractiemetdeomgevingis.hetismoeilijktebepalenofvirussennu eigenlijk leven,indegebruikelijkezinvanhetwoord.welvertonenzeactiviteiten reagerenzeophunomgeving,vindterreplicatieplaatsenzijnzeonderhevigaan evolutiedeverscheidenheidaanvirussenisenorm,evenalsdeaantallenwaarinze voorkomen.binnendevirusklassetreffenweverschillendegeneraaan,diekunnen Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 11

12 worden ingedeeld in acht groepen op basis van aanwezigheid van een coating, opslagvangenetischeinformatieinrnaofdnaenhetaldannietdubbelstrengs aanwezigzijnvandezegenetischeinformatie(riede&werner,2004,pp ) Tabel 1 Indeling van virussen (Riede & Werner, 2004, pp ) Coating Uncoated Coated RNAof DNA RNA DNA RNA Enkelof dubbelstrengs Enkelstrengs Dubbelstrengs Enkelstrengs Dubbelstrengs Enkelstrengs Dubbelstrengs Enkele families Picornaviridae Reoviridae Parvoviridae Adenoviridae Papovaviridae Miopapovavirida e Tagoviridae Flaviviridae Orthomoxyviridae Paramyxoviridae Arenaviridae Rhabdoviridae Retroviridae Poxviridae Herpesviridae Veroorzaken o.a. Poliomyelitis HepatitisA Diarreebij kinderen Hemolytische anemie Gastroenteritis Rubella Influenza Mazelen Rabies AIDS Pokken HerpesZoster DNA Enkelstrengs Hepadnaviridae HepatitisB Deze indeling is zeker niet uitputtend: er zijn veel andere en meer precieze methoden om virussen in te delen, waarvan de Baltimore classificatie een bekende,maarvrijingewikkeldeis. 6 Dematewaarineenvirusinstaatiseenziekte ofsymptomendaarvanteveroorzakenwordtdevirulentievaneenvirusgenoemd. Hoegroterdevirulentie,hoeschadelijkerhetvirus.Sommigevirussenzijnzelfszo virulent,datzehuneigenverspreidingbemoeilijken,zoalshetebolavirus.hetvirus demobiliseert het slachtoffer zo snel (en dood het), dat besmetting van andere 6 Zie bijv.: personen bemoeilijkt wordt. Een organisme kan op verschillende manieren geïnfecteerdzijndooreenvirus: Tabel 2 Typen infecties en gevolgen (Riede & Werner, 2004) Typeinfectie Gevolgenvoorvirusengastcel Latent Noncytocidaal Lytisch Transformerend geenreplicatievanvirusindegastheercel,ofverandering vandegastcel. vormingvannieuwevirusdeeltjes,zonderdatdenormale celfunctieverstoordwordt Virusreproductieleidttotdoodvandecel Resulteertinongecontroleerdecelgroei 1.4 Oorzaak van influenza: het influenzavirus Griepwordtveroorzaaktdoorinfectiemethetinfluenzavirus.Vanhetviruszijndrie genera(influenzaa,benc) 7 bekend,waarvaninfluenzaaenbverantwoordelijk zijnvoorinfluenzadiejaarlijksvelemensenaanhunbedkluistertinnederlanden vele andere delen van de wereld. Influenza C veroorzaakt een onschuldig ziektebeeld,datopverkoudheidlijkt.influenzaaisverantwoordelijkvoordedrie grotepandemieënvande20 e eeuw.naastdemensishetenigeandereorganisme dat (zover bekend) gevoelig is voor influenza B de zeehond. (Osterhaus, Rimmelzwaan,Martina,Bestebroer,&Fouchier,2000)Hetvirusisin1933voorhet eerstgeïsoleerddoordeamerikaanwilsonsmithenzijnteam.hetinfluenzavirus (Figuur 1) behoort tot de familie van orthomyxoviridae, welke behoren tot de togaviridae, de groep gecoate virussen met een enkele streng RNA (Tabel 1). Scheiding van de verschillende subtypen A, B en C gebeurt op basis van de verschillende nucleuseiwitten. Influenza A en B bevatten acht afzonderlijke RNA segmenten die alle voor verschillende eiwitten coderen (waarvan er in totaal 11 ontdektzijn).influenzacbevatzevenafzonderlijkernasegmenten.(earn,dushoff &Levin,2002) 7 Zie bijv.: of 12 BramHengeveld,oktober2009

13 manierdevirussubtypentedefiniërenismeninstaatomdeevolutievanhetvirus inkaarttebrengen(zieookfiguur4) Figuur 2 schema voor naamgeving van influenzavirussen Figuur 1 Influenzavirus door Tunneling Electron Microscope (TEM) AanduidingvaninfluenzaAsoortengeschiedtviadeHxNxnotatie,waarbijdeHen N staan voor resp. hemaglutinine (HA) en neuraminidase (NA). HA en NA zijn eiwittendiezich(deels)aandebuitenzijdevanhetvirusbevindenenwaaraande verschillendesubtypenvanhetinfluenzaavirusteherkennenzijn.vandehaen NAeiwittenzijneenaantalvariantenbekend:15HAen19NA.Deverschillende hemaglutinine en neuraminidase zijn genummerd waardoor een classificatie ontstaat.bekendevariantenzijnheth1n1enh5n1virus,dieveelindemediazijn geweest en beter bekend zijnals resp Nieuwe Influenza A/H1N1 (ook wel: de Mexicaanseofvarkensgriep)en devogelgriep.(aviaireinfluenza) Omonderscheidtemakentussendeveleverschillendeinfluenzavirussen,gebruikt menhetnotatiesysteemwaarvaninfiguur2eenvoorbeeldwordtgetoond.een uitzonderinghieropvormtheteerstevirusdatgeïsoleerdwerd,datisvernoemd naar de ontdekker Wilson Smith: A/WilsonSmith/1933 (H1N1). Door op deze Besmetting De overdracht van humane influenza verloopt via drie wegen: 1. via droplets (kleinedruppels)diedirectopdeslijmvliezenvandeluchtwegenwordengeniestof gehoest,2.viaaerogenedruppels(dropletnuclei),zeerkleinedruppeltjesdievrij traag dalen en zo worden overgedragen van persoon tot persoon (Figuur 3) en tenslotte 3. besmetting via fysiek contact kan direct of indirect plaatsvinden (via eentussenkomendobject).welkevandezebesmettingswijzenverantwoordelijkis voor de meeste besmettingen wordt is onderwerp van onderzoek. (Weber & Stilianakis, 2008) De minimale besmettingsdosis is zeer laag: één tot enkele virusdeeltjes volstaan voor een geslaagde infectie. Ter vergelijking: voor het experimenteel besmetten via neusdruppels zijn honderdmaal meer virusdeeltjes nodig. Het lijkt daarom waarschijnlijk dat overdracht via bijvoorbeeld toetsenbordeneenveelkleinerebijdragelevertdanverspreidingviadelucht.de grootste kans op besmetting is aanwezig in besloten ruimtes. (Landelijke CoördinatieInfectieziekten,2008)Alsdevirussenovergedragenwordtvandeene naar de andere persoon, dringt het virus het lichaam binnen via cellen van het respiratoir epitheel in de neus, pharynx, larynx, trachea en bronchiën. Hiervoor gebruikt het speciale receptor cellen waarmee het virus zich hecht aan bovengenoemde weefsels. Wanneer besmetting is opgetreden, stijgt het aantal doordebesmettepersoongeproduceerdevirusdeeltjesscherpbinneneendagen ismengemiddeld5 7dagenbesmettelijk. Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 13

14 bindingaangastcel,replicatievanrnaingastcel,virulentiefactoren(beïnvloeden bijv.celdood(apoptosis)ofontwijkingvanimmuunsysteemvangastorganisme)en het vormen van nieuwe virions. (Earn,Dushoff & Levin, 2002) Deze virusdeeltjes kunnen weer andere cellen infecteren, kopieën van zichzelf laten maken, enz. Regulatievanautofagieblijkteenbelangrijkeroltespelenbijinfluenza.(Zhouetal. 2009)Voor iemand die behandeld wordt voor influenza zijn echter een tweetal fasenbelangrijk,nl.defasewaarinhetvirusdiensmanteldientteverliezenende fasewaarinhetvirusuitdecelmoetworden geloodst.(grant,2003)waaromdit zo is, zal worden toegelicht in de paragraaf behandeling van influenza in het hoofdstuk Preventie en Behandeling (pag. 21). Gedurende het verblijf in een gastheer worden er van het virus geen perfecte kopieën gemaakt; er kunnen kleinere en grotere veranderingen optreden in de genetische samenstelling en daarmee in de bouw van het virus die zorgen voor een diversiteit in zowel influenzaaalsininfluenzabvirussen. Figuur 3 druppelvorming tijdens niezen OnderzoekaandeMayoClinicheeftechteraangetoonddatbijeengroepvan41 metinfluenzaabesmettepersonen(vnl.ouderen)meerdandehelftopofnadag 7virusdeeltjesverspreidden.(Leekhaetal.2007)Symptomenkomenbijgemiddeld 67% van de infecties voor, waarbij influenza A virulenter is. (Carrat etal., 2008). Eenanderevormvanbesmettingmetinfluenzaverlooptviacontacttussenmens en dier. Dit komt sporadisch voor (bijv. bij veeartsen), maar biedt dan wel de mogelijkheid tot het ontstaan van een kruising tussen humane en niethumane influenza.ditkanleidentoteeninfluenzapandemieenwordtdaaromnauwlettend indegatengehouden.innederlandishetnationaalinfluenzacentrum(nic)hier verantwoordelijkvoor.(zieookdeparagraaf epidemiologie oppag.16) Replicatie van het virus in het lichaam Alshetvirushetlichaamisbinnengedrongen,beginthetzichtevermenigvuldigen in de bovenste luchtwegen. Het virus zet het lichaam aan tot het maken van kopieënvanzichzelf.ditverlooptineenaantalfasen,waarbijallereersteenvirus de cel dient binnen te dringen, kopieën van zichzelf te laten maken en deze vervolgens weer uit de cel, het lichaam in te sturen. De verschillende RNA segmenten (en daarbij behorende eiwitten) hebben hierin verschillende rollen: Antigene shift & antigene drift Virussenzijnbijzondergoedinstaatomzichaantepassenaanhunomgeving.Het veroorzaken van epidemieën en pandemieën berust er in deze op dat de genetische informatie in het virus aan mutatie onderhevig is in de vorm vanantigeneshiftenantigenedrift.bijantigeneshiftisersprakevaneenvrijgrote veranderingindegenetischecodevanhetvirus,doorvervangingvanbestaande HAen/ofNAdoornieuweversies.Bijhetontstaanvaneenvirulentviruskandit bijzonder dodelijke gevolgen hebben, zoals de epidemie van de Spaanse griep (H1N1),dietussende50en100miljoendodenheeftveroorzaakt.Alleeninfluenza A heeft tot dusver antigene shift vertoond en de humane variant heeft dat de afgelopenhonderdjaar,driekeergedaan,hetgeenresulteerdeineenpandemie, eenwereldwijdeuitbraakvaninfluenza. Eenbelangrijkprocesdataandebasisvanantigeneshiftligt,ishetrecombineren van genetische informatie, waarbij genetische informatie wordt uitgewisseld tussen twee verschillende influenza A of B subtypen die één gastheer hebben geïnfecteerd. Dit is mogelijk omdat er in een jaar meerdere typen van het virus rondwaren.eenandereoorzaakvanantigeneshiftwordtgevormddoordeinfectie van één organisme door twee of meerdere virustypen (Figuur 8, pag 20) die normaal twee verschillende soorten organismen besmetten, maar niet beide organismen, dus een directe besmetting van dier op mens. (Carrat & Flahault, 2007)DiteendegroteangstwatbetreftinfluenzaA(H5N1)enmeerrecentook 14 BramHengeveld,oktober2009

15 H1N1.Dekansdatopdezemaniereenbijzondervirulentsubtypeontstaatdatvan mens op mens overdraagbaar is, is aanwezig. Wanneer variatie in de HA en NA eiwittenoptreedtinkleine(opeenvolgende)stappen,spreektmenvangenetische drift. Zowel influenza A als B vertonen genetische drift. De kleine mutaties van puntenophaennawaaraanantilichamenzichkunnenbindenzijnfrequentmaar doorgaansneutraal.eenkleindeelvandezemutatiesbelemmertechterdebinding van antilichamen aan het virus, waardoor het virus niet meer voor het lichaam herkenbaar is. Er zullen geen, of minder antilichamen aan kunnen binden. De verschillendegeneraentypeninfluenzavertonenopverschillendewijzeantigene drift: influenza A/H1Nx en influenza B komen in verschillende subtypen naast elkaarvoor(zieookfiguur4).influenzaa/h3vertoontmeerantigenedriftwaarbij oudesubtypenwordenverdrongendoornieuwesubtypen.(hay,gregory,douglas, &Lin,2001)OverdepreciezekenmerkenvanantigenedriftininfluenzaAisvrij weinigbekendenbekendegegevens(matevandriftgedurendeeenbepaaldetijd, mate van evolutionaire selectiedruk door gastimmuniteit of vaccinatie) kennen veel verschillen tussen verschillende virussen, plaatsen en/of tijden. (Boni, 2008; Russelletal.2008)Ookiseronderzoekdatduidtopeenverschillendewijzevan muterenvaninfluenzaaenb.(guanzhuhan,liu&li,2008)endemogelijkheid vanverschillendeinfluenzabvirussenomsamente combineren toteennieuw virus.(matsuzaki,etal.,2004) herkenbaar. Wel is er vaak sprake van kruisimmuniteit: wanneer het lichaam immuunisgewordennainfluenzainfectiegeldtditook(inverminderdemate)voor andere virussen dan die de infectie hebben veroorzaakt. (Grebe, Yewdell & Bennink,2008) 1.5 Afweer en immuniteit Bij de bestrijding van influenza door het lichaam zijn een aantal afweermechanismenactiefineenscalaaanelkaaropvolgendeprocessen.(poland, Ovsyannikova&Jacobson,2008)Voorendirectnadeinfectiemethetvirusisde aspecifieke afweer actief, het mechanisme dat het lichaam dient te beschermen tegen in feite iedere binnendringing door nietlichaamseigen stoffen, m.b.v. fagocytoseenproductievanhistamine.nainfectietreedtookdespecifiekeafweer inwerking:hetlichaamkanzichmetbehulpvanditsysteemimmuunmakenvoor hetinfluenzavirus,doorhetvormenvanantistoffentegenhetvirus.hetlichaam vormt B en Tgeheugencellen (m.n. HA levert een immunogene reactie op), waarna bij hernieuwde infectie het virus snel herkend en onschadelijk gemaakt wordt.deopgebouwdeimmuniteitvoorinfluenzaisechtermeestalmaarvankorte duur: antigene shift en drift zorgen ervoor dat de eiwitten waar het virus aan herkendwordtaanveranderingonderhevigzijn:eengemuteerdvirusisnietmeer Figuur 4: Fylogenetische verwantschap van de eiwitten (a) Hemaglutinine (HA) en (b) Neuraminidase (NA) van influenza B virussen. De relatieve afstand geeft aan hoeveel nucleotiden de verschillende virussen van elkaar verschillen in de genen die coderen voor HA(linker kolom) en NA (rechterkolom). (Hay, Gregory, Douglas, & Lin, 2001, p. 1867) Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 15

16 1.6 Epidemiologie Het tegelijkertijd voorkomen op grote schaal van verschillende virusstammen en subtypen (Finkelman et al. 2007), de wisselende virulentie (die ook samenhangt meteerdereinfectiesbijéénendezelfdepersoon)enaanwezigheidvangenetische drift maken dat de verspreiding en evolutie van het influenzavirus zeer lastig te onderzoekenis.destandaardmodellendiegebruiktwordenvooronderzoeknaar de epidemiologie van infectieuze ziekten zijn bij influenza niet of nauwelijks te gebruiken, gezien de zeer snel groeiende complexiteit en omvang van de berekeningen.(earn,dushoff,&levin,2002).deveelgebruiktemethodewaarbij excess mortality t.g.v. influenza en pneumonie de belangrijkste informatie bron vormt is al sinds lange tijd in gebruik (Langmuir, 1964) Een onderzoek naar de verspreidingdoordetijdtijdenseenepidemievaninfluenzaah1n1,ah3n2en influenza B gedurende het tijdsvak in gematigde delen van het noordelijk en zuidelijk halfrond heeft echter een aantal eigenschappen van de epidemiologievaninfluenzablootgelegd.zoblijkthetvoorkomenvaninfluenzaa H3N2ineensynchroonverbandplaatsvindentussendetweehemisfereneniser eenverbandtussendetijdvanhetjaarvanhetopkomenvanhetinfluenzaavirus endelengtegraad(afstandtotdeevenaar).hoeverdereenlandvandeevenaar verwijderdis,hoelaterdeopkomstvaninfluenzaa.enalhoeweleengrootdeel van de influenzaactiviteit in de wintermaanden plaatsvindt, is er gedurende de andere delen van het jaar ook vrij veel influenzaactiviteit, waarbij deze overlap toont in de verschillende (sub)type en verspreiding over de twee halfronden. InfluenzaBkomtsignificantlatervoordaninfluenzaA,waarbijinfluenzaAH3N2 significantmeervoorkomtdaninfluenzaah1n1eninfluenzab,zowelgedurende epidemische perioden als nietepidemische perioden. Ook is de verspreiding van influenzaah3n2overdewereldgroterdandievaninfluenzaah1n1eninfluenza B (Finkelman et al. 2007). Alhoewel in de meer gematigde klimaten influenza epidemischvoorkomt,komthetinandere,meerwarmeklimatenendemischvoor enveroorzaaktookdaaraanzienlijkeziektelastensterfte(monto,2008) Incidentie & Prevalentie VoorhetmetenvandeincidentieenprevalentievaninfluenzainNederlandheeft NIVEL sinds 1970 een netwerk opgezet de CMR peilstations. Momenteel telt het netwerk 65 huisartsen in 44 huisartsenpraktijken, die aan ongeveer 1% van de totale bevolking zorg verlenen:de gegevens die deze praktijken leveren vormen de Continue Morbiditeits Registratie. (Donkers, 2007) De gegevens van deze CMR peilstation worden wekelijks geüpdate en zijn via internet te raadplegen(figuur5).erdienttewordenvermeld datnaar schatting30% vande IAZ gevallen bijde huisarts daadwerkelijk is veroorzaakt door influenza en dat ongeveer 30% van de gevallen wordt gemeld bij de huisarts. Gegevens over incidentie van Influenza worden doorgaans per seizoen aangegeven en niet per jaar. Op deze manierwordtvoorkomendattweeepidemieëndie inhetzelfdejaarvalleneenvertekendbeeldgeven van de werkelijkheid. (Gijsen & Poos, 2005) Op basis van cijfers van de seizoenen en stelt het RIVM vast dat per seizoen ongeveer10opde1000mensenzichmeteeniaz meldenbijdehuisarts.intabel3isdeincidentiete zienvanhetseizoen2002/2003,waaruitblijktdat metnamekinderenindeleeftijdvan04jaarmet IAZ vatbaar zijn voor infectie met influenza. Influenza wordt buiten de wintermaanden praktisch nooit geïsoleerd in Nederland: de prevalentie ervan is gedurende de rest van het jaar dus erg laag. Het RIVM verwacht op basis van demografische gegevens dat het aantal gevallen van influenzatussen2005en2025met2,8%zaltoenemen.(vanderplas&wilbrink, 2005) Epidemieën Tabel 3 Gemiddelde incidentie per personen in de periode 2002/03 t/m 2003/04 (van der Plas & Wilbrink, 2005) Leeftijd Incidentie 0 23, , , , , , , , , , , , , , , , , , ,12 Tijdenseenepidemieisersprakevaneensterkverhoogdeactiviteitvaninfluenza. Men spreekt van een epidemie wanneer er sprake is van meer dan 51 IAZ per inwoners, gemeten door CMR peilstations. De eerste beschrijvingen van influenzaepidemieëndaterenuitde12 e eeuw,maarwaarschijnlijkgafhippocrates reeds een beschrijving van een influenzaepidemie. In de winter van komenvolgensdebeschrijvingenveelrespiratoireinfectiesvoor.influenzakomtin 16 BramHengeveld,oktober2009

17 Nederlandiederjaarepidemischvoorindewintermaanden(Figuur5),waarbijop de wereldniveau gezien verschillende virus(sub)typen naast elkaar circuleren. Er zijn aanwijzingen dat de jaarlijkse epidemieën in de gematigde regio s van de wereld sinds 2002 veroorzaakt door influenza A H3N2 vanuit (Zuid Oost) Azië optrekken,diedaargedurendehetjaarplaatselijkeepidemieënvoorzaakt.(russell etal.2008) In de periode tussen 1979 en 2004 heeft Nederland vijf influenzaepidemieën gekenddieeengrotesterftehebbenveroorzaakt,tewetenin1985/86,1989/90, 1993/94,1995/96en1999/2000.Indezeperiodewasersprakevanrespectievelijk 3000, 4000, 3000 en 2000 meer sterfgevallen dan verwacht. (van der Plas & Wilbrink, 2005). In figuur 7 is een overzicht te zien van de influenzaactiviteit in Nederlandvan /09. Figuur 7 overzicht influenza-activiteit in Nederland sinds 1996 (EISS, 2008) Figuur 5 Incidentie van influenza-achtig ziektebeeld van het seizoen 1970/1971 tot en met het seizoen 2003/2004 (van der Plas & Wilbrink, 2005) Op landelijk niveau domineert er hoofdzakelijk één influenza A virussubtype. Influenza A speelt m.b.t. mortaliteit en morbiditeit een (veel) grotere rol dan influenza B. De epidemieën verschillen per jaar in omvang, maar de gemiddelde incidentievaniazissinds1970trendmatiggedaaldinnederland.(figuur6) Pandemieën Inde20 e eeuwheeftdemensheiddriegroteinfluenzapandemieëngekend,nl.in 1918 (H1N1), 1957 (H2N2) en in 1968 (H3N2). Deze zijn vernoemd naar de (vermoedelijke)plaatsvanontstaan,resp.despaanse,deaziatischeendehong Kong griep. Het gaat in alle gevallen om een bepaald subtype van influenza A, veroorzaaktdoorantigeneshift.erbleekspraketezijnvangroteverschilleninde hemagglutinine en neuraminidase eiwitten. (Kilbourne, 2006) Deze pandemieën hebben aan miljoenen mensen het leven gekost. Wetenschappers zijn voor de komendepandemieoverdehelewereldactiefommogelijkeverklaringentetesten envoorspellingenovereenvolgendepandemietekunnendoen.wereldwijdzijn groteprojectenopgerichtomeenuitbraaktekunnenpareren.overigenswileen pandemienietzeggendaterperdefinitiesprakeisvaneenzeerhogemortaliteit. Zozijnerepidemieënbekenddiedodelijkwarendandemilderepandemieën. Figuur 6 Grafiek van gemelde IAZ per inwoners Nieuwe Influenza A/H1N1 Gezien de op het moment van schrijven grote aandacht voor Nieuwe Influenza A/H1N1( Mexicaanse of varkensgriep )ishetinteressantomhiereenparagraaf aantewijden.dewaarschijnlijkeoriginevanhetvirusdatdemexicaansegriepis eenvarken.(vandaarookdeterm varkensgriep of swineflu ).Onderzoekuit1991 heeft bewijs geleverd voor de theorie dat varkensgriep is ontstaan t.g.v. de besmetting van varkens met het influenza H1N1 virus dat de Spaanse griep Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 17

18 veroorzaakte. Dit virus heeft een verwachte oorsprong in vogels, van waaruit tevensalleandereinfluenzaasubtypenzijngeëvolueerd.deh1,n1enpb1genen van de Spaanse griep stammen af van aviaire influenzavirussen. (Gorman et al, 1991)Hetgrotegevaardatineendergelijkvirusschuiltisdemogelijkheidvanco infectievanéénorganismemetverschillendesubtypeninfluenzaadiesameneen nieuw virus kunnen vormen (Figuur 8). In het geval van influenza A H5N1 (de aviaireinfluenza)zoudateenviruskunnenopleverendatmakkelijkvanmensop mensoverdraagbaaris.naastdereedsbestaandevirulentieendeonbekendheid vanhetmenselijkimmuunsysteemmethethemagglutinine5eiwitvanheth5n1 viruszoudateenpandemiekunnenopleverenmetdesastreuzegevolgen.opdit momentzijnbesmettingenvanmensopmenszeldzaam,maareriswelsprakevan eenuitbraakvanaviaireinfluenzaondergevogelteinazië,europaenafrika.(cdc, 2009)Recentonderzoekheeftnieuweaanwijzingengegevenvoordeontwikkeling van een mogelijk pandemisch virus: het blijkt dat aviaire influenzavirussen niet goed gedijen in de temperatuur van de luchtwegen van de mens. Waar deze temperatuurbijvogelsrondde40cligt,isdezebijdemensongeveer37c(scull et al. 2009). Grootste risicogebieden voor het ontstaan van een pandemisch influenzaviruszijngebiedenwaargevogelteenmenseninnauwcontactverblijven. Totophedenzijneroverdegehelewereld423gevallenvanH5N1besmettingbij mensenbekend,waarvaner258fataalwaren.(who,2009)demogelijkedreiging vaneenpandemisch varkensgriep virusheeftechterookdeaandachtopandere gebieden gericht. Hiernaast (Figuur 8) is een afbeelding opgenomen waarin is weergegeven hoe een combinatie van verschillende influenzavirussen kan resulterenineennieuw,pandemischvirus Morbiditeit & mortaliteit (co)morbiditeit Onderdebevolkingzijnereenaantalgroependieeenverhoogdekanshebbenop eenernstigverloopvaninfluenza(zieooktabel4).hetgaathierbijmetnameom ouderen (in Nederland vanaf 60 jaar), mensen met een chronische aandoening (diabetes,copd,nierpatiënten,mensenmethartenvaatziektenetc.)enmensen meteenomwelkeredendanookverlaagdeweerstand.secundairelonginfecties zijn het meest voorkomend, maar ook een afwijkend ECG (gevaarlijk voor chronische hartpatiënten) en hersenaandoeningen komen voor t.g.v. influenza. (vanderplas&wilbrink,2005)eriseenduidelijkverbandbeschreven tussen het voorkomen van een verhoogde sterfte t.g.v. hartafwijkingen ten tijde vaneeninfluenzaepidemie(mamas,fraser&neyses,2008)ookvoorzwangere vrouwen (met en zonder onderliggende aandoeningen) geldt dat wordt aangenomen dat ze een hoger risico hebben op complicaties t.g.v. influenza. (Monto, 2008)Onderzoek naar de gemiddelde ziektelast uitgedrukt in gemiste werkdagenperpersoontoontaandatdezevoorserologischbevestigdeinfluenza tussende1,5en4,9dagenbedraagt.(keech&beardsworth,2008). Influenza als doodsoorzaak Influenza als doodsoorzaak is lastig vast te stellen. Volgens het RIVM zijn de geleverde cijfers waarschijnlijk veel te laag, aangezien niet alle door influenza veroorzaakte en fatale complicaties als overlijden ten gevolge van influenza wordengeregistreerd.(vanderplas&wilbrink,2005)depiekvaniazdieiederjaar optreedt valt samen met de jaarlijkse piek van sterfte aan hart, long en vaatziekten. Uit de gegevens van het CBS blijkt duidelijk dat influenza vooral bij oudereneenfataleafloopkanhebben,metnameindegroep85+.omdeomvang vandesterftedoorinfluenzavasttestellengebruiktmendebovenmatigesterfte diezichgedurendeeeninfluenzaepidemieduidelijklaatzien,invergelijkingmet derestvanhetjaar.(simonsenetal.2007;langmuir1964)indeperiodetussen 1979 en 2004 heeft Nederland vijf influenzaepidemieën gekend die een hoge mortaliteit kenden, te weten in 1985/86, 1989/90, 1993/94, 1995/96 en 1999/2000.Indezeperiodewasersprakevanrespectievelijk3000,4000,3000en 2000meersterfgevallendanverwacht.(vanderPlas&Wilbrink,2005)Indecijfers van het CBS is te zien dat de doodsoorzaak influenza (ICD10; J10 & J11) in combinatie met een daadwerkelijke vaststelling van infectie(icd10; J10) met influenzarelatiefvrijweinigvoorkomt;vande491gevallentussen2005en2007 waarbijinfluenzaalsdoodsoorzaakisvastgesteld,isin25gevallen(5%)hetvirus ookgeïdentificeerd.(cbs,2008)onderzoeknaardeeffectenvaninfluenzaindevs hebben schattingen gegeven van meer dan verloren levensjaren. (Molinari, 2007) Mortaliteit t.g.v. influenza op wereldschaal wordt op sterfgevallenperjaargeschat(WHO,2003). Ziekenhuisopname Ziekenhuisopnamentengevolgevaninfluenzavormeneengrootprobleem,zeker gedurende een heftige epidemie. Met name ouderen zijn hierbij slachtoffer; het aantal hospitalisaties t.g.v. influenza in deze groep is vele malen hoger dan in andere groepen (Nichol, 2005). Een onderzoek in Spanje gaf aan dat met name 18 BramHengeveld,oktober2009

19 pneumonie en chronische bronchitis verantwoordelijk waren voor hospitalisatie (Lenglet et al. 2007) Molinari et al. (2007) berekenden 3,1 miljoen gehospitaliseerde dagent.g.v.influenzaindevs Financiële gevolgen van influenza De financiële gevolgen van influenza zijn moeilijk te bepalen, gezien het probleem van definiëring van gevolgen van influenza. Naar schattingliggeninnederlanddekostenvanhet ziekteverzuim door influenza tussen de 150 en 500 miljoen euro per jaar (Blijleven & van der Geest, 2002). Meer gegevens werden niet gevonden over de financiële gevolgen van influenza in Nederland. Molinari et al. (2007) schattendetotalekostenvaninfluenzaindevs op87miljarddollarperjaar. Tabel 4 Sterfte per personen aan influenza (primaire doodsoorzaak) in 2003 (van der Plas & Wilbrink, 2005) Leeftijd Mannen Vrouwen 0 0,00 0, ,00 0, ,00 0, ,00 0, ,00 0, ,00 0, ,00 0, ,00 0, ,00 0, ,00 0, ,17 0, ,18 0, ,74 0, ,51 0, ,95 1, ,93 0, ,95 2, ,26 6, ,40 41,87 Influenza,eenliteratuurstudie(metvoorliefdevoordegeriatrischezorg) 19

20 Figuur 8 Mechanismen voor het ontstaan van een pandemisch influenzavirus 20 BramHengeveld,oktober2009

Influenza Een literatuurstudie (met voorliefde voor de geriatrische zorg) Bram Hengeveld Saxion Hogescholen Enschede 80058@student.saxion.

Influenza Een literatuurstudie (met voorliefde voor de geriatrische zorg) Bram Hengeveld Saxion Hogescholen Enschede 80058@student.saxion. Influenza Een literatuurstudie (met voorliefde voor de geriatrische zorg) Bram Hengeveld Saxion Hogescholen Enschede 80058@student.saxion.nl 2 Bram Hengeveld, juni 2009 Inhoudsopgave Inleiding... 5 Zoekmethode...

Nadere informatie

Influenza surveillance

Influenza surveillance Influenza surveillance Tijdens de pandemie Hoe het begon in 2009 Begin april eerste infecties Verenigde Staten/Mexico In Nederland 1 e infectie 30 april 11 juni : WHO pandemie Interpandemische fase Laag

Nadere informatie

GRIEPVACCINATIE VOOR ZORGVERLENERS Hoe kan griep voorkomen worden?

GRIEPVACCINATIE VOOR ZORGVERLENERS Hoe kan griep voorkomen worden? GRIEPVACCINATIE VOOR ZORGVERLENERS Hoe kan griep voorkomen worden? WAT IS SEIZOENSGRIEP? WAT IS SEIZOENSGRIEP? > Een acute luchtweginfectie: Plots begin met koorts en rillingen Hoofdpijn Spierpijn Keelpijn

Nadere informatie

Samenvatting. Etiologie. samenvatting

Samenvatting. Etiologie. samenvatting Samenvatting Hoofdstuk 1 is een algemene inleiding op dit proefschrift. Luchtweginfecties zijn veel voorkomende aandoeningen, die door een groot aantal verschillende virussen en bacteriën veroorzaakt kunnen

Nadere informatie

Nieuwe Influenza A (H1N1)

Nieuwe Influenza A (H1N1) Nieuwe Influenza A (H1N1) Overzicht 11 december 29, week 5 Samenvatting In de afgelopen week is het aantal ziekenhuisopnamen wegens een laboratoriumbevestigde infectie met Nieuwe Influenza A (H1N1) afgenomen

Nadere informatie

Nieuwe Influenza A (H1N1)

Nieuwe Influenza A (H1N1) Nieuwe Influenza A (H1N1) Overzicht 23 oktober 29, week 43 Samenvatting In de afgelopen week is het aantal ziekenhuisopnamen wegens een laboratoriumbevestigde infectie met Nieuwe Influenza A (H1N1) verdubbeld

Nadere informatie

Nieuwe Influenza A (H1N1)

Nieuwe Influenza A (H1N1) Nieuwe Influenza A (H1N1) Overzicht 6 november 29, week 45 Samenvatting In de afgelopen week is het aantal ziekenhuisopnamen wegens een laboratoriumbevestigde infectie met Nieuwe Influenza A (H1N1) wederom

Nadere informatie

NIEUWSBRIEF INFLUENZA-SURVEILLANCE 2009/10

NIEUWSBRIEF INFLUENZA-SURVEILLANCE 2009/10 NIEUWSBRIEF INFLUENZA-SURVEILLANCE 2009/10 Een uitgave van: Nationaal Influenza Centrum (NIC): Rotterdam (Erasmus MC), Bilthoven (RIVM); Nederlands instituut voor onderzoek van de gezondheidszorg (NIVEL);

Nadere informatie

Samenvatting. Griepvaccinatie: wie wel en wie niet?

Samenvatting. Griepvaccinatie: wie wel en wie niet? Samenvatting Griepvaccinatie: wie wel en wie niet? Griep (influenza) wordt veroorzaakt door het influenzavirus. Omdat het virus steeds verandert, bouwen mensen geen weerstand op die hen een leven lang

Nadere informatie

Griep en griepvaccinatie. Infodocument

Griep en griepvaccinatie. Infodocument Griep en griepvaccinatie Infodocument Griep en griepvaccinatie 1 Wat is griep? Griep wordt veroorzaakt door het influenzavirus en wordt daarom ook wel influenza genoemd. Het influenzavirus veroorzaakt

Nadere informatie

GRIEPVACCINATIE 2012. Waardoor komt het? Wat zijn de verschijnselen? Adviezen

GRIEPVACCINATIE 2012. Waardoor komt het? Wat zijn de verschijnselen? Adviezen GRIEPVACCINATIE 2012 De griepprik zal dit jaar op woensdag 14 november worden gegeven, tussen 15 en 18 uur. Mensen die ervoor in aanmerking komen krijgen ongeveer 2 weken van tevoren een uitnodiging toegestuurd.

Nadere informatie

Inhoud. Inleiding 7. 1. Medische achtergrondkennis 9 - Anatomie en fysiologie 10 - Ziektebeelden 17

Inhoud. Inleiding 7. 1. Medische achtergrondkennis 9 - Anatomie en fysiologie 10 - Ziektebeelden 17 Inhoud Inleiding 7 1. 9 - Anatomie en fysiologie 10 - Ziektebeelden 17 2. De intake 23 - Ernst van de klachten 24 - Het intakegesprek 26 3. Geneesmiddelen 31 - Medicijnen tegen griep en verkoudheid 32

Nadere informatie

Aanpak van griep bij het varken: een uitdaging? Dr. Tom Meyns MERIAL Belgium

Aanpak van griep bij het varken: een uitdaging? Dr. Tom Meyns MERIAL Belgium Aanpak van griep bij het varken: een uitdaging? Dr. Tom Meyns MERIAL Belgium Inhoud Influenza Epidemiologie - verspreiding Ziektebeeld Klassieke uitbraken Chronische problemen Complicaties Belang en economische

Nadere informatie

Lijst vragen MONDELING EXAMEN

Lijst vragen MONDELING EXAMEN Academiejaar: 2009-2010 Basisopleiding: Bachelor BIOMEDISCHE LABTECHNOLOGIE Afstudeerrichting: ALLE OPTIES Module: BLT 11 Immunologie en virologie Partim: Semester: 3 Lector: Virologie Nicole Kellner Lijst

Nadere informatie

Griep en griepvaccinatie 1/5

Griep en griepvaccinatie 1/5 Griep en griepvaccinatie 1/5 E-info Griep en griepvaccinatie 1 Wat is griep? Griep wordt veroorzaakt door het influenzavirus en wordt daarom ook wel influenza genoemd. Het influenzavirus veroorzaakt een

Nadere informatie

Ziekteverwekkende micro-organismen dringen via lichaamsopeningen het lichaam binnen:

Ziekteverwekkende micro-organismen dringen via lichaamsopeningen het lichaam binnen: IMMUNITEIT 1 Immuniteit Het lichaam van mens en dier wordt constant belaagd door organismen die het lichaam ziek kunnen maken. Veel van deze ziekteverwekkers zijn erg klein, zoals virussen en bacteriën.

Nadere informatie

Stilleestekst deel 1. Figuur 1: aantal nieuwe gevallen (incidentie) van influenza in functie van de leeftijd. Stilleestekst deel 1 Pagina 1 van 12

Stilleestekst deel 1. Figuur 1: aantal nieuwe gevallen (incidentie) van influenza in functie van de leeftijd. Stilleestekst deel 1 Pagina 1 van 12 Figuur 1: aantal nieuwe gevallen (incidentie) van influenza in functie van de leeftijd. Stilleestekst deel 1 Pagina 1 van 12 Epidemiologie (tekst 1) Epidemiologie bestudeert de verspreiding van ziekten

Nadere informatie

Nederlandse samenvatting MUCOSALE ADJUVANS ACTIVITEIT VAN LIPOSOMEN

Nederlandse samenvatting MUCOSALE ADJUVANS ACTIVITEIT VAN LIPOSOMEN 102 Nederlandse samenvatting MUCOSALE ADJUVANS ACTIVITEIT VAN LIPOSOMEN 103 104 Mucosale immunoadjuvans activiteit van liposomen Inleiding Het menselijk lichaam is voortdurend bezig indringers zoals bacteriën,

Nadere informatie

Inhoud. Inleiding 7. 1. Medische achtergrondkennis 9 - Anatomie en fysiologie 10 - Ziektebeelden 17

Inhoud. Inleiding 7. 1. Medische achtergrondkennis 9 - Anatomie en fysiologie 10 - Ziektebeelden 17 Inhoud Inleiding 7 1. 9 - Anatomie en fysiologie 10 - Ziektebeelden 17 2. Zorgvraag verhelderen 23 - Recepten 24 - Zelfzorgvragen 30 3. Geneesmiddelen 37 - Medicijnen tegen griep en verkoudheid 38 - De

Nadere informatie

Influenza vaccinatie van ziekenhuismedewerkers

Influenza vaccinatie van ziekenhuismedewerkers Influenza vaccinatie van ziekenhuismedewerkers Achtergrond Het RIVM en Vernet Verzuimnetwerk B.V. hebben een onderzoek uitgevoerd onder ziekenhuismedewerkers naar de relatie tussen de influenza vaccinatiegraad

Nadere informatie

Verkoudheid; virale infectie; respiratoir syncytieel virus; vaccins; antivirale middelen

Verkoudheid; virale infectie; respiratoir syncytieel virus; vaccins; antivirale middelen Niet-technische samenvatting 2015107 1 Algemene gegevens 1.1 Titel van het project Dierstudies in het kader van ontwikkeling van medicijnen voor het behandelen en voorkomen van virale infecties aan de

Nadere informatie

Hoesten, niezen en neus snuiten in papieren zakdoekje. Zakdoekje direct weggooien. Handen wassen met water en zeep. ZO HOUDEN WE GRIP OP GRIEP

Hoesten, niezen en neus snuiten in papieren zakdoekje. Zakdoekje direct weggooien. Handen wassen met water en zeep. ZO HOUDEN WE GRIP OP GRIEP Hoesten, niezen en neus snuiten in papieren zakdoekje. Zakdoekje direct weggooien. Handen wassen met water en zeep. ZO HOUDEN WE GRIP OP GRIEP Lees deze brochure aandachtig. In deze brochure staat praktische

Nadere informatie

@rboinfect alertsysteem

@rboinfect alertsysteem Samenvatting: Nieuwe website van VWS Arboprofessionals werkzaam de gemeente Arboprofessionals o.a. werkzaam in het onderwijs Griep Check Nederlands Huisartsen genootschap Niet zorg: wanneer mag ik weer

Nadere informatie

Zwangerschap en vaccinatie tegen Nieuwe Influenza A (H1N1) ZO HOUDEN WE GRIP OP GRIEP

Zwangerschap en vaccinatie tegen Nieuwe Influenza A (H1N1) ZO HOUDEN WE GRIP OP GRIEP Zwangerschap en vaccinatie tegen Nieuwe Influenza A (H1N1) ZO HOUDEN WE GRIP OP GRIEP Zwangerschap en vaccinatie tegen Nieuwe Influenza A (H1N1) Nieuwe Influenza A, ook wel Mexicaanse griep genoemd, geeft

Nadere informatie

NIEUWSBRIEF INFLUENZA-SURVEILLANCE 2009/10

NIEUWSBRIEF INFLUENZA-SURVEILLANCE 2009/10 NIEUWSBRIEF INFLUENZA-SURVEILLANCE 2009/10 Een uitgave van: Nationaal Influenza Centrum (NIC): Rotterdam (Erasmus MC), Bilthoven (RIVM); Nederlands instituut voor onderzoek van de gezondheidszorg (NIVEL);

Nadere informatie

Nederlandse Samenvatting

Nederlandse Samenvatting Nederlandse Samenvatting Respiratoir syncytieel virus Het respiratoir syncytieel virus (RSV) is een veroorzaker van luchtweginfectiesvan de mens. Het komt bij de mens met name in het winterseizoen voor.

Nadere informatie

RBPi INFLUENZA BIJLAGEN Vaccinatie strategie pandemie

RBPi INFLUENZA BIJLAGEN Vaccinatie strategie pandemie 9.5 Inleiding Tijdens de jaarlijkse influenza-epidemie overlijden gemiddeld 233 personen, wat neerkomt op 0,15 sterfgevallen per 10.000 inwoners per jaar (bron Nationaal Kompas Volksgezondheid Influenzasterfte

Nadere informatie

FES-AI onderzoek als respons op de uitbraak

FES-AI onderzoek als respons op de uitbraak Tjeerd Kimman Nu weten we (niet) alles De afkortingen: FES: Fonds Economische Structuurversterking AI: Aviaire Influenza FES-AI: Impulse Program on Avian Influenza De uitbraak van 2003 in kille cijfers

Nadere informatie

Infectiepreventie. De jaarlijkse griepprik

Infectiepreventie. De jaarlijkse griepprik Infectiepreventie De jaarlijkse griepprik 1 De jaarlijkse griepprik Deze folder informeert u over de vaccinatie tegen de seizoensgriep. U krijgt deze folder omdat u, net als uw collega s, ook dit jaar

Nadere informatie

BCOU PROTOCOL NIEUWE INFLUENZA A H1N1, DE ZOGENAAMDE MEXICAANSE GRIEP, VERSIE 26 AUGUSTUS 2009 / IVK

BCOU PROTOCOL NIEUWE INFLUENZA A H1N1, DE ZOGENAAMDE MEXICAANSE GRIEP, VERSIE 26 AUGUSTUS 2009 / IVK BCOU PROTOCOL NIEUWE INFLUENZA A H1N1, DE ZOGENAAMDE MEXICAANSE GRIEP, VERSIE 26 AUGUSTUS 2009 / IVK MEDE OP BASIS VAN NOTITIE NUOVO Teksten voor website PCOU en Willibrord Het H1N1-influenzavirus (de

Nadere informatie

Cover Page. The handle http://hdl.handle.net/1887/37049 holds various files of this Leiden University dissertation.

Cover Page. The handle http://hdl.handle.net/1887/37049 holds various files of this Leiden University dissertation. Cover Page The handle http://hdl.handle.net/1887/37049 holds various files of this Leiden University dissertation. Author: Gooskens, Jairo Title: Molecular and clinical insights into seasonal and pandemic

Nadere informatie

Nederlandse samenvatting

Nederlandse samenvatting Nederlandse samenvatting Chapter 9 Inleiding Het dengue virus (DENV) en het West Nijl virus (WNV) behoren tot de Flaviviridae, een familie van kleine sferische virussen met een positief-strengs RNA genoom.

Nadere informatie

Bof Brief ouders (t.e.m. 4 de leerjaar)

Bof Brief ouders (t.e.m. 4 de leerjaar) 246 DRAAIBOEK INFECTIEZIEKTEN CLB Bof Brief ouders (t.e.m. 4 de leerjaar) KORTE VERSIE VOOR MEER INFORMATIE ZIE ANDERE ZIJDE Beste ouder(s), Een medeleerling van uw dochter of zoon heeft dikoor (bof).

Nadere informatie

Antwoorden voor professionelen op vragen over griepvaccinatie / 29.06.2015

Antwoorden voor professionelen op vragen over griepvaccinatie / 29.06.2015 / dossier DOSSIER GRIEP 2015 Antwoorden voor professionelen op vragen over griepvaccinatie / 29.06.2015 29.06.2015 dossier griep 2015 1/15 Inhoudstafel 1 Influenza 3 1.1 Hoe ernstig is griep? 3 1.2 Welke

Nadere informatie

INFECTIEZIEKTEN. H.H. TAN, arts 2015

INFECTIEZIEKTEN. H.H. TAN, arts 2015 INFECTIEZIEKTEN H.H. TAN, arts 2015 INFECTIEZIEKTEN 2 - PANDEMIE * Als een epidemie zich naar andere landen verspreidt * Spaanse griep 1918 (20-40miljoen slachtoffers, vnl. jonge, gezonde mensen van

Nadere informatie

Het RS-virus bij uw baby/kind

Het RS-virus bij uw baby/kind Het RS-virus bij uw baby/kind 2 Bij uw kind is het RS-virus vastgesteld. In deze folder leest u wat het RS-virus is en wat de gevolgen ervan zijn. Daarnaast vindt u informatie over de medische en verpleegkundige

Nadere informatie

Kinkhoest is gevaarlijk voor zuigelingen en jonge kinderen

Kinkhoest is gevaarlijk voor zuigelingen en jonge kinderen Samenvatting Kinkhoest is gevaarlijk voor zuigelingen en jonge kinderen Kinkhoest is een gevaarlijke ziekte voor zuigelingen en jonge kinderen. Hoe jonger het kind is, des te vaker zich restverschijnselen

Nadere informatie

Kinkhoest. Kinkhoest of pertussis is een acute bacteriële infectie van de luchtwegen.

Kinkhoest. Kinkhoest of pertussis is een acute bacteriële infectie van de luchtwegen. Kinkhoest Ziektebeeld Kinkhoest of pertussis is een acute bacteriële infectie van de luchtwegen. Het ziektebeeld kan variëren van een milde hoest tot ernstige ziekte. Klassiek wordt kinkhoest gekenmerkt

Nadere informatie

Informatie voor zorgpersoneel. Vaccinatie tegen Nieuwe Influenza A (H1N1) Bescherming tegen de Mexicaanse Griep ZO HOUDEN WE GRIP OP GRIEP

Informatie voor zorgpersoneel. Vaccinatie tegen Nieuwe Influenza A (H1N1) Bescherming tegen de Mexicaanse Griep ZO HOUDEN WE GRIP OP GRIEP Informatie voor zorgpersoneel Vaccinatie tegen Nieuwe Influenza A (H1N1) Bescherming tegen de Mexicaanse Griep 1 ZO HOUDEN WE GRIP OP GRIEP U ontvangt deze folder omdat u in aanmerking komt voor een vaccinatie

Nadere informatie

Veterinaire volksgezondheid en vogelinfluenza

Veterinaire volksgezondheid en vogelinfluenza Veterinaire volksgezondheid en vogelinfluenza NVAG themamiddag d.d. 02-03 2006, Utrecht Prof.dr. Frans van Knapen influenza virus typeringen: H-antigeen N-antigeen Permanente veranderingen in influenza

Nadere informatie

Bronchiolitis bij kinderen

Bronchiolitis bij kinderen Kindergeneeskunde Bronchiolitis bij kinderen i Patiënteninformatie Slingeland Ziekenhuis Algemeen Uw kind is opgenomen in het ziekenhuis omdat het een ontsteking van de kleine luchtwegen heeft. Lang niet

Nadere informatie

Vragen en antwoorden over ebola

Vragen en antwoorden over ebola Vragen en antwoorden over ebola 2 oktober 2014 Wat is ebola? Het ebolavirus veroorzaakt een zeldzame maar zeer ernstige infectieziekte die in Afrika voorkomt. De ziekteverschijnselen zijn: hoge koorts,

Nadere informatie

Inhoudsopgave. Wat is RSV? 3. Hoe kunt u RSV herkennen? 3. Hoe gevaarlijk is RSV? 4. Is RSV besmettelijk? 5. Is een RSV-infectie te voorkomen?

Inhoudsopgave. Wat is RSV? 3. Hoe kunt u RSV herkennen? 3. Hoe gevaarlijk is RSV? 4. Is RSV besmettelijk? 5. Is een RSV-infectie te voorkomen? RSV-infectie Inhoudsopgave Wat is RSV? 3 Hoe kunt u RSV herkennen? 3 Hoe gevaarlijk is RSV? 4 Is RSV besmettelijk? 5 Is een RSV-infectie te voorkomen? 6 RSV: wat moet u onthouden? 7 Medische behandeling

Nadere informatie

Richtlijn INFLUENZA. Oktober 2012. Richtlijn Influenza oktober 2012 1

Richtlijn INFLUENZA. Oktober 2012. Richtlijn Influenza oktober 2012 1 Richtlijn INFLUENZA Deze richtlijn is tot stand gekomen via een intercollegiale discussie tussen de leden van de NVAVG commissie Infectieziekten en preventie met terugkoppeling ter evaluatie naar een regionale

Nadere informatie

Kinkhoest: niet alleen een kinderziekte!

Kinkhoest: niet alleen een kinderziekte! Kinkhoest: niet alleen een kinderziekte! Informatiefolder over kinkhoest (preventie) Kinkhoest niet alleen een kinderziekte Kinkhoest is een infectie van de luchtwegen die wordt veroorzaakt door de bacterie

Nadere informatie

Hepatitis B Inleiding Hepatitis A Preventie hepatitis B Preventie hepatitis A

Hepatitis B Inleiding Hepatitis A Preventie hepatitis B Preventie hepatitis A Naast deze infokaart over hepatitis zijn er ook infokaarten beschikbaar over: infectieziekten algemeen, tuberculose, seksueel overdraagbare aandoeningen, jeugd en onveilig vrijen en jeugd en vaccinatie.

Nadere informatie

achtergronddocument bij de richtlijn influenza preventie en begeleiding door de bedrijfsarts

achtergronddocument bij de richtlijn influenza preventie en begeleiding door de bedrijfsarts achtergronddocument bij de richtlijn influenza preventie en begeleiding door de bedrijfsarts Colofon NVAB 2007 Uitgave NVAB Kwaliteitsbureau NVAB Postbus 2113 3500 GC Utrecht t 030 2845750 e kwaliteitsbureau@nvab-online.nl

Nadere informatie

Virussen zonder grenzen

Virussen zonder grenzen Virussen zonder grenzen Prof. Eric Snijder Afdeling Medische Microbiologie Leids Universitair Medisch Centrum 1 Inferno, een kolfje naar mijn hand 2 1 2012... MERS Nature, October 4, 2012 3 Ebola 4 2 Ebola...

Nadere informatie

Grieppandemie. Wat moet u weten over een grieppandemie (wereldgriep)?

Grieppandemie. Wat moet u weten over een grieppandemie (wereldgriep)? Grieppandemie Wat moet u weten over een grieppandemie (wereldgriep)? Grieppandemie 2 Wat leest u in deze folder? Deze folder gaat over een grieppandemie (wereldgriep). U leest de antwoorden op 10 belangrijke

Nadere informatie

Inhoud. Inleiding 7. 1. Medische achtergrondkennis 9 - Virussen en bacteriën 10 - Het afweersysteem 14 - Ziektebeelden 19

Inhoud. Inleiding 7. 1. Medische achtergrondkennis 9 - Virussen en bacteriën 10 - Het afweersysteem 14 - Ziektebeelden 19 Inhoud Inleiding 7 1. 9 - Virussen en bacteriën 10 - Het afweersysteem 14 - Ziektebeelden 19 2. De intake 25 - Ernst van de klachten 26 - Het intakegesprek 27 3. Geneesmiddelen 33 - Medicijnen tegen kinderziektes

Nadere informatie

Diagnostische toets Van HIV tot AIDS?

Diagnostische toets Van HIV tot AIDS? Diagnostische toets Van HIV tot AIDS? Moleculen 1. Basenparing In het DNA vindt basenparing plaats. Welke verbinding brengt een basenpaar tot stand? A. Peptidebinding B. Covalente binding C. Zwavelbrug

Nadere informatie

Hoe kan de griepvaccinatiegraad bij 50- tot 65- jarige risicopatiënten verbeterd worden?

Hoe kan de griepvaccinatiegraad bij 50- tot 65- jarige risicopatiënten verbeterd worden? Hoe kan de griepvaccinatiegraad bij 50- tot 65- jarige risicopatiënten verbeterd worden? Van Nuffel Eline, Vrije Universiteit Brussel Promotor: Prof. Dr. Vandevoorde Jan, Vrije Universiteit Brussel Master

Nadere informatie

WERKMODEL: BELEID BIJ GRIEPPANDEMIE

WERKMODEL: BELEID BIJ GRIEPPANDEMIE WERKMODEL: BELEID BIJ GRIEPPANDEMIE Versie voor oplevering FOD Volksgezondheid, Veiligheid van de Voedselketen, en Leefmilieu; Directoraat-generaal Basisgezondheidszorg en Crisisbeheer. Datum oplevering:

Nadere informatie

LAAT GRIEP DEZE WINTER IN DE KOU STAAN

LAAT GRIEP DEZE WINTER IN DE KOU STAAN LAAT GRIEP DEZE WINTER IN DE KOU STAAN 10 vragen over griepvaccinatie GRIEPVACCINATIE.BE AGENTSCHAP ZORG & GEZONDHEID 1. Waarom vaccinatie tegen griep? Vaccinatie is de enige manier om je tegen griep en

Nadere informatie

Niet technische samenvatting. 1 Algemene gegevens. 2 Categorie van het project

Niet technische samenvatting. 1 Algemene gegevens. 2 Categorie van het project Niettechnische samenvatting 1 Algemene gegevens 1.1 Titel van het project Respiratoir Syncytieel Virus (RSV) in kalveren 1.2 Looptijd van het project 1.3 Trefwoorden (maximaal 5) Oktober 2015 oktober 2020

Nadere informatie

Ik laat me vaccineren tegen seizoensgriep! U toch ook?

Ik laat me vaccineren tegen seizoensgriep! U toch ook? vzw AZ Alma campus sijsele Gentse Steenweg 132 B-8340 Sijsele-Damme tel. 050 72 81 11 campus eeklo (Maatschappelijke Zetel) Moeie 18 B-9900 Eeklo tel. 09 376 04 11 www.azalma.be PERSBERICHT AZ Alma promoot

Nadere informatie

Inleiding Symptomen Werking van de neus

Inleiding Symptomen Werking van de neus VERKOUDHEID 202 Inleiding U komt op de polikliniek Keel-, Neus- en Oorheelkunde, omdat u last heeft van verkoudheid. Verkoudheid is een ontsteking van het slijmvlies in uw neus, bijholten en uw keel. Verkoudheid

Nadere informatie

Kwartaaloverzicht meldingsplichtige infectieziekten in het kader van de Wet Publieke Gezondheid

Kwartaaloverzicht meldingsplichtige infectieziekten in het kader van de Wet Publieke Gezondheid Kwartaaloverzicht meldingsplichtige infectieziekten in het kader van de Wet Publieke Gezondheid Hierbij ontvangt u het overzicht van de gemelde infectieziekten die bij de afdeling I&H van de GGD Haaglanden

Nadere informatie

Het influenza winterseizoen 2008/ 09 in Nederland en de vaccinsamenstelling voor het seizoen 2009/'10

Het influenza winterseizoen 2008/ 09 in Nederland en de vaccinsamenstelling voor het seizoen 2009/'10 Het influenza winterseizoen 2008/ 09 in Nederland en de vaccinsamenstelling voor het seizoen 2009/'10 Jan C.de Jong, Guus F.Rimmelzwaan, Gé A.Donker, Adam Meijer, Ron A.M.Fouchier en A.D.M.E. (Ab) Osterhaus

Nadere informatie

VERKOUDHEID OF GRIEP?

VERKOUDHEID OF GRIEP? VERKOUDHEID OF GRIEP? Een verkoudheid wordt meestal veroorzaakt door besmetting met een virus. Die kan via speekseldruppeltjes maar meestal besmetten we ons zelf nadat we met onze handen in contact zijn

Nadere informatie

DOSSIER GRIEPVACCINATIE 2014

DOSSIER GRIEPVACCINATIE 2014 / dossier DOSSIER GRIEPVACCINATIE 2014 Antwoorden voor professionelen op vragen over griepvaccinatie / 24.06.2014 24.06.2014 Dossier griepvaccinatie 2014 1/16 Inhoudstafel 1 Welke Influenza-virussen veroorzaken

Nadere informatie

Tweede Kamer der Staten-Generaal

Tweede Kamer der Staten-Generaal Tweede Kamer der Staten-Generaal 2 Vergaderjaar 2006 2007 22 894 Preventiebeleid voor de volksgezondheid Nr. 130 BRIEF VAN DE MINISTER VAN VOLKSGEZONDHEID, WELZIJN EN SPORT Aan de Voorzitter van de Tweede

Nadere informatie

Cover Page. The handle http://hdl.handle.net/1887/18950 holds various files of this Leiden University dissertation.

Cover Page. The handle http://hdl.handle.net/1887/18950 holds various files of this Leiden University dissertation. Cover Page The handle http://hdl.handle.net/1887/18950 holds various files of this Leiden University dissertation. Author: Velthuis, Arend Jan Wouter te Title: A biochemical portrait of the nidovirus RNA

Nadere informatie

Dr. B. BROCHIER WIV - Virologie J. Wytsmanstraat, 14 1050 Brussel Tel. : 02/642.55.98 Fax : 02/642.56.92

Dr. B. BROCHIER WIV - Virologie J. Wytsmanstraat, 14 1050 Brussel Tel. : 02/642.55.98 Fax : 02/642.56.92 1. Gegevens van het referentielaboratorium Dr. B. BROCHIER WIV - Virologie J. Wytsmanstraat, 14 1050 Brussel Tel. : 02/642.55.98 Fax : 02/642.56.92 2. Programmaverantwoordelijke contactpersoon Dr Isabelle

Nadere informatie

Dit dossier geeft een antwoord op veel gestelde vragen over griep en wil eventuele misverstanden uit de weg ruimen.

Dit dossier geeft een antwoord op veel gestelde vragen over griep en wil eventuele misverstanden uit de weg ruimen. Dossier Griepvaccinatie 2013 Dit dossier geeft een antwoord op veel gestelde vragen over griep en wil eventuele misverstanden uit de weg ruimen. Inhoud 1. Welke Influenza-virussen veroorzaken griep? 2.

Nadere informatie

Vaccinatie baarmoederhalskanker. Gynaecologie

Vaccinatie baarmoederhalskanker. Gynaecologie Vaccinatie baarmoederhalskanker Gynaecologie Inleiding Als u nog nooit van het Humaan Papillomavirus (hierna te noemen: HPV) en baarmoederhalskanker heeft gehoord, dan bent u niet de enige. Ondanks het

Nadere informatie

Tuberculose & risicogroepen

Tuberculose & risicogroepen Tuberculosebestrijding Tuberculose & risicogroepen Themadag De Tweede MIJL Maria Knapen Sociaal verpleegkundige tuberculosebestrijding 11 oktober 2014 Programma Introductie Ziektebeeld tuberculose Bron

Nadere informatie

respiratoire virale infecties: evaluatie van de huidige PCR Sarah Resseler 31 maart 2009

respiratoire virale infecties: evaluatie van de huidige PCR Sarah Resseler 31 maart 2009 Laboratoriumdiagnose van respiratoire virale infecties: evaluatie van de huidige PCR Sarah Resseler 31 maart 2009 Inhoud 1. Algemene inleiding 2. Klinisch/diagnostisch scenario 3. CAT vraagstelling 4.

Nadere informatie

VRIJE ST.-LAMBERTUSSCHOLEN WESTERLO. Influenza. H5N1 op weg naar een pandemie? JOEY LEMMENS 6HW

VRIJE ST.-LAMBERTUSSCHOLEN WESTERLO. Influenza. H5N1 op weg naar een pandemie? JOEY LEMMENS 6HW VRIJE ST.-LAMBERTUSSCHOLEN WESTERLO Influenza H5N1 op weg naar een pandemie? JOEY LEMMENS 6HW 2008-2009 VRIJE ST.-LAMBERTUSSCHOLEN WESTERLO Influenza H5N1 op weg naar een pandemie? JOEY LEMMENS 6HW 2008-2009

Nadere informatie

Mocht u vragen hebben dan kunt u terecht bij de leidinggevende van uw locatie.

Mocht u vragen hebben dan kunt u terecht bij de leidinggevende van uw locatie. Informatie aan ouders over zieke kinderen Voorwoord Uitgaande van de richtlijnen van de GGD heeft onze organisatie een beleid ontwikkeld dat handvatten geeft bij eventuele ziekte van uw kind(eren). Dit

Nadere informatie

ZA5222. Flash Eurobarometer 287 (Influenza H1N1) Country Specific Questionnaire Belgium (Flemish)

ZA5222. Flash Eurobarometer 287 (Influenza H1N1) Country Specific Questionnaire Belgium (Flemish) ZA5222 Flash Eurobarometer 287 (Influenza H1N1) Country Specific Questionnaire Belgium (Flemish) FLASH 287 INFLUENZA Q1. Bent u van plan zich te laten vaccineren tegen de seizoensgriep dit jaar? Ja, ik

Nadere informatie

4. Bereiden 49 - Rekenen 50 - Bereiden 52. 8. Persoonlijke groei 81 - Feedback 82

4. Bereiden 49 - Rekenen 50 - Bereiden 52. 8. Persoonlijke groei 81 - Feedback 82 Inhoud Inleiding 7 1. 9 - Virussen en bacteriën 10 - Het afweersysteem 14 - Ziektebeelden 19 2. Verhelderen van de zorgvraag 25 - Recepten 26 - Zelfzorgvragen 33 3. Geneesmiddelen 39 - Medicijnen tegen

Nadere informatie

VIB. V.U.: Jo Bury, VIB vzw, Rijvisschestraat 120, 9052 Gent januari 2013. facts series. Griepvirus

VIB. V.U.: Jo Bury, VIB vzw, Rijvisschestraat 120, 9052 Gent januari 2013. facts series. Griepvirus griep VIB VIB (Vlaams Instituut voor Biotechnologie) is een non-profit onderzoeksinstituut in de levenswetenschappen. 1.300 wetenschappers verrichten strategisch basisonderzoek naar de moleculaire basis

Nadere informatie

Veelgestelde vragen over mazelen

Veelgestelde vragen over mazelen Veelgestelde vragen over mazelen Inhoud Wat is er aan de hand? Over de ziekte mazelen Vragen voor ouders met kinderen Vragen voor volwassenen Vragen voor werknemers in gezondheidszorg Vaccin tegen mazelen

Nadere informatie

De klinische relevantie van genetische variatie van de gastheer bij bacteriële meningitis

De klinische relevantie van genetische variatie van de gastheer bij bacteriële meningitis De klinische relevantie van genetische variatie van de gastheer bij bacteriële meningitis Marieke Sanders, PhD student Lab. Immunogenetica & Kinderinfectieziekten VUmc Servaas Morré & Marceline van Furth

Nadere informatie

IMMUUN WORDEN EN BLIJVEN

IMMUUN WORDEN EN BLIJVEN IMMUUN WORDEN EN BLIJVEN I. EEN GEZONDE BABY Julia is een paar weken geleden bevallen van een zoon: Onno. Op het consultatiebureau komt Julia van alles te weten over hoe ze voor Onno moet zorgen, zodat

Nadere informatie

Knutselen met virussen

Knutselen met virussen Tekst: Emile Hilgers Beeld: Levien Willemse FOCUS: VOGELGRIEP Knutselen met virussen Hoe verandert een virus dat niet de eigenschap heeft om van mens op mens over te gaan in een virus dat dat wél doet?

Nadere informatie

De overeenkomsten tussen de ziekte van Parkinson en de ziekte van Huntington

De overeenkomsten tussen de ziekte van Parkinson en de ziekte van Huntington Wetenschappelijk nieuws over de Ziekte van Huntington. In eenvoudige taal. Geschreven door wetenschappers. Voor de hele ZvH gemeenschap. Succesvolle gentherapiestudie bij de ziekte van Parkinson geeft

Nadere informatie

De rol van virussen bij verteringsstoornissen bij varkens en pluimvee. Naomi de Bruijn

De rol van virussen bij verteringsstoornissen bij varkens en pluimvee. Naomi de Bruijn De rol van virussen bij verteringsstoornissen bij varkens en pluimvee Naomi de Bruijn Virale darminfecties: Algemeen Betreft vooral jonge dieren Meer ziekte verschijnselen Veelal relatief milde darmschade

Nadere informatie

Wat is een RS-infectie

Wat is een RS-infectie Het RS-virus Wat is een RS-infectie Het RS (Respiratoir Syncytieel)-virus is de meest voorkomende verwekker van luchtweginfecties bij zuigelingen en peuters. Dit virus kan het hele jaar door infecties

Nadere informatie

De zin en onzin van griepvaccinatie

De zin en onzin van griepvaccinatie De zin en onzin van griepvaccinatie Sense and nonsense of influenza vaccination dr. W. van der Hoek 1, dr. A.B. van Gageldonk-Lafeber 2, dr. L. van Asten 2, dr. A. Meijer 3 Samenvatting Er is regelmatig

Nadere informatie

REIZEN EN TUBERCULOSE

REIZEN EN TUBERCULOSE REIZEN EN TUBERCULOSE Op reis naar Oost-Europa Afrika Azië Midden-Amerika Zuid-Amerika In deze folder staan enkele maatregelen die u kunt nemen om uzelf te beschermen LANGER DAN 3 MAANDEN VEEL CONTACT

Nadere informatie

Een verkoudheid? Acupunctuur kan helpen. Kou vatten

Een verkoudheid? Acupunctuur kan helpen. Kou vatten Een verkoudheid? Acupunctuur kan helpen Kou vatten Het overkomt ieder wel eens door koude te worden gevat. In de volksmond noemt men dit een verkoudheid. Eigenlijk is het een aanval van een virus op de

Nadere informatie

Geschreven door Diernet Team zondag, 31 oktober 2010 00:00 - Laatst aangepast zondag, 31 oktober 2010 14:56

Geschreven door Diernet Team zondag, 31 oktober 2010 00:00 - Laatst aangepast zondag, 31 oktober 2010 14:56 Omschrijving Oorzaken Verschijnselen Diagnose Therapie Prognose Omschrijving Rhinitis is een ontsteking van de slijmvliezen van de neus. Sinusitis is een ontsteking van de sinussen (de bijholten) of de

Nadere informatie

Het influenzaseizoen 2007/ 08 in Nederland: antigene variatie, resistentie tegen oseltamivir en de vaccinsamenstelling voor het seizoen 2008/ 09

Het influenzaseizoen 2007/ 08 in Nederland: antigene variatie, resistentie tegen oseltamivir en de vaccinsamenstelling voor het seizoen 2008/ 09 De influenza-epidemie van 2007/ 08 begon laat, net zoals in de 3 voorgaande seizoenen het geval was. 1-3 In week 9 van 2008 werd de maximale klinische influenza-activiteit van 7,2 IAZ s per 10.000 inwoners

Nadere informatie

Antwoorden op kamervragen van de Kamerleden Van Gerven en Langkamp over vaccinatie tegen polio, bof, mazelen en rodehond.

Antwoorden op kamervragen van de Kamerleden Van Gerven en Langkamp over vaccinatie tegen polio, bof, mazelen en rodehond. Antwoorden op kamervragen van de Kamerleden Van Gerven en Langkamp over vaccinatie tegen polio, bof, mazelen en rodehond. (2080910270) 1 Wat is uw reactie op het bericht dat de gepromoveerde arts P. uit

Nadere informatie

Influvac 2011/2012, suspensie voor injectie 0,5 ml (influenza vaccin, oppervlakte antigeen, geïnactiveerd).

Influvac 2011/2012, suspensie voor injectie 0,5 ml (influenza vaccin, oppervlakte antigeen, geïnactiveerd). 1.3.1 Summary of Product Characteristics, Influvac 2011/2012 1. NAAM VAN HET GENEESMIDDEL Influvac 2011/2012, suspensie voor injectie 0,5 ml (influenza vaccin, oppervlakte antigeen, geïnactiveerd). 2.

Nadere informatie

antidepressivum, rat, overerfbaar, mechanismen, gedrag

antidepressivum, rat, overerfbaar, mechanismen, gedrag 1 Algemene gegevens 1.1 Titel van het project Effecten van het antidepressivum vortioxetine op hersenmechanismen in genetische diermodellen voor depressie 1.2 Looptijd van het project 1.3 Trefwoorden (maximaal

Nadere informatie

Zorgeenheid Reumatologie en Klinische Immunologie, locatie AZU. Langwerkende antireumatische middelen: TNF-remmers: Adalimumab (Humira )

Zorgeenheid Reumatologie en Klinische Immunologie, locatie AZU. Langwerkende antireumatische middelen: TNF-remmers: Adalimumab (Humira ) Zorgeenheid Reumatologie en Klinische Immunologie, locatie AZU Langwerkende antireumatische middelen: TNF-remmers: Adalimumab (Humira ) In overleg met uw behandelend arts heeft u besloten het geneesmiddel

Nadere informatie

Golimumab (Simponi ) Bij colitis ulcerosa. Informatiefolder. NNIC folder Golimumab uitgave november 2014

Golimumab (Simponi ) Bij colitis ulcerosa. Informatiefolder. NNIC folder Golimumab uitgave november 2014 Golimumab (Simponi ) Bij colitis ulcerosa Informatiefolder NNIC folder Golimumab uitgave november 2014 Deze folder is tot stand gekomen door samenwerkende IBD verpleegkundigen en MDL artsen binnen respectievelijk

Nadere informatie

Het is een goed moment om na te denken over de toekomst van het RVP

Het is een goed moment om na te denken over de toekomst van het RVP Samenvatting Het is een goed moment om na te denken over de toekomst van het RVP Sinds 1957 worden Nederlandse kinderen gevaccineerd tegen infectieziekten. Dat gebeurt in het kader van het zogenoemde Rijksvaccinatieprogramma

Nadere informatie

Hieronder vindt u een kort overzicht van de nieuwe producten en/of de promoties die we momenteel aanbieden in de apotheek.

Hieronder vindt u een kort overzicht van de nieuwe producten en/of de promoties die we momenteel aanbieden in de apotheek. Beste klant, Hieronder vindt u een kort overzicht van de nieuwe producten en/of de promoties die we momenteel aanbieden in de apotheek. Voor vragen kan u ons gerust contacteren op het telefoonnummer 052/30.94.14

Nadere informatie

Brabant-Zuidoost. Zicht op Q-koorts. Ronald ter Schegget. arts infectieziektebestrijding. GGD Brabant-Zuidoost

Brabant-Zuidoost. Zicht op Q-koorts. Ronald ter Schegget. arts infectieziektebestrijding. GGD Brabant-Zuidoost Zicht op Q-koorts Ronald ter Schegget arts infectieziektebestrijding GGD Brabant-Zuidoost 1 Kernboodschap Q-koorts kunt u oplopen door het inademen van de bacterie. Wees alert op de verschijnselen van

Nadere informatie