Rechts daarvan zie je de viewer, waarin je je clips bekijkt en in en uitpunten zet met de shortcuts i en o,voordat je ze in de timeline sleept.

Maat: px
Weergave met pagina beginnen:

Download "Rechts daarvan zie je de viewer, waarin je je clips bekijkt en in en uitpunten zet met de shortcuts i en o,voordat je ze in de timeline sleept."


1 Interface:Linksziejedebrowser,waarinjealjemateriaalvooreenproductiesequence importeertenordentinmappenofbins.zoalsjeziet,staaneraltweefolders/binsinde browser;éénvoorvideoenéénvooraudio.jekannieuwebinsmakeno.a.vooralje grafischefilesonderhetfilemenu>new>bin.indebrowservindjealleinfo.overje clipszoalslengte,in enuitpunt,samplerate,datarate,audiorateenformaatenz. Rechtsdaarvanziejedeviewer,waarinjejeclipsbekijktenin enuitpuntenzetmetde shortcuts ieno,voordatjezeindetimelinesleept. Alsjejevideowerklaterwil afspelenoptv,moetjede title safe instellinggebruiken,zodat detekstnietbuitenhettv beeld verdwijnt.debuitenstelijnen zijn actionsafe lijnen binnenstelijnenmarkerende veiligeplekvoortekst. Indetimelinebouwjejevideosequencesop,waarvanjedebewerkingindecanvasziet. BijFCEziejeonderRTlinksbovendeingesteldesysteem settingsvande playbackcontrol.

2 Rechtsziejedevideo sporen1&2enaudio1 tm4:dev1 knop geeft aanwaarjeclipkomt (hierophet2de videospoorv2)ende stereo knoppena1en a2gevenaandatje bijbehorendeaudioop kuntdeindicatorenv1, a1ena2verslepennaar hetgewenstespoor. NueenkortebeschrijvingvandeFCE toolbarlinks 1 : Depijlisdeselecttool,waarmeejeclipsselecteerttetrimmenente verplaatsen.onderdeselecttoolziejedeedit selecttoolenselectforwardtool,daaronderdebelangrijkstetoolsinnon lineairevideo, namelijkdetrimtoolsomjevideozocompactmogelijktemakenomaan hetdoeltebeantwoorden.deroll toolsveranderenalleendein en uitpuntenvantweeopvolgendeclips,zonderdegehelelengtevande sequenceteveranderen.metdeslide toolskanjedemontagepuntenvan drieverschillendeclipstegelijkveranderen,zodatjesequencelangerof korterwordt.methetscheermesjekanjesnijdeninjeclipsomeenlasin tevoegen.methetvergrootglaskanjeindetijdslijnofcanvas zoomen; onderhetvergrootglasvindjeeenhandjeeneenscrubtool.metde pentoolskanjepuntenzetteninde overlays (=volumeregelinginde audioen/oftransparantieindevideo). Inde toolbar vindjedeaudiometers,diedemeeste editorsrond 12Dbwillenhouden;alsjeopdeze digitalemeter0decibellenhaalt,gaatjeaudio vervormen. Jekandevensters dynamisch herschikkennaarje wensen,maarookonderdewindowtab>arrange kiezenvoorbijvoorbeeld voice over omeen commentaarbijjevideointespreken.eropentzich eenvensterwaarbijjemeteenkangaanopnemen: Jekanook shortcutbuttons toevoegenindevenstersdooronderde toolstab inhet menuop buttonlist teklikkenendesymbolennaardetopvanwelkvensterdanookte slepen. 1 DetoolsinPremièreElements7werkenvegelijkbaarmetdievananderebekende Adobeprogramma szoalspremièrepro,aftereffects&photoshop.

3 Materiaal importeren: Maakopeenschijf(liefstextern)eenfolderaanvooralje Video projecten,diejebijvoorbeeldvideonoemt. Voordatjemateriaalvanjedv camera importeertsluitjedecameraeerstmetfire wireaanvoordatjehetprogrammaopstart. OnderhetFinalCutExpress menusteljedesysteem settingsinzoalsde scratchdisk endefolder,diejenethebtaangemaaktomeenav archiefoptebouwen 2.Jekunteen aantalterugspeeloptieszoalsrt unlimited,videokwaliteit dynamic enframerate full instellen;ondereasy Setupkiesjebijvoorbeeld all formats, all rates endv PAL(= Europeseanalogekleurentelevisieformaat). Jeopentnuonderhetfile menueennieuwprojectenslaathetoponderjeprojectnaam enkiesteennieuwebin,diejeindebrowsereennaamgeeft.alsje ctr+klikt opdebin kanjeinhetuitklapmenukiezenvoorset Capture Bin, zodat alhetnieuwtecapturen materiaalindiefoldergezetwordt 3.AlsjeonderhetfilemenuvoorCapturekiestopent hetvolgendevenster: Hetordenenenbenoemenvanjeclipfragmentenisergbelangrijkomoverzichtte houdenoverhetproject,dusgeefduidelijkeclipnamen.zorgdatjegenoegvoorenna hetgewenstefragment captured, zgn. handels omlater transitions tekunnen toepassen.fragmentenkanjedirectmetcapture nowbinnenhalen.fceheeftgeen mediamanager,dushetisniethandigomalhetmateriaalinjelaptoptecapturen. 2 AlsjemetHDD camcorderswerkt,moetjehetbestandini moviecapturen,naam gevenenexporterenalsfcexml file;jekuntditxml filenuinfceimporteren.lukt ditniet,danmoetjedebestandenopjebureaubladkopiëreneneerstdempeg 2 muxedbestandenscheidenmetmpeg streamclip: sleeptjempeg 2muxedfileophetstreamclipschermenkiestonderfiledemux to unscaled M2V and AIFF.Jeopentdem2vfileindeQT playerenbewaarthetals zelfstandigeqt movieinjefce map,diejenukuntimporteren. AVCHD camera sdieindiedigitaalmpeg 4/H.264opnemenzijnwelcompatibelmet FCEopIntel macs:jekiestlog and transfer onderhetfilemenu. 3 Hetiseenreferentienaardefysiekemediaindescratchdisk.

4 Metdeprojectknopkanjelater(alsjedeorigineletapesmetdoorlopendetimecodenog hebt)alleofflinefragmentenweerophalenvanafdemini dv tape. Bijhetimporterenvanmuziekinjeproject(uiti tunesofvaneencd)moetjeoppassen metcopyrights;muziekluisterenisietsandersdangebruikenineenproductie 4. Narratieve strategie:alseditorprobeerjeuithetbeschikbaremateriaaldebeste fragmententecombinerentoteenspannendverhaalomdeaandachtvandekijkervast tehouden.jemixtbijvoorbeeldtotaal,medium,close up enextremeclose upsshotsen snijdtpreciesindeactieomeennatuurlijkeovergangencontinuïteitte bewerkstelligen 5. Storyboard:Jekandelangeclipsorganiserendoorzeinsubclipsoptedelen 6.Jesnijdt hetmateriaaldatjenietgaatgebruikenwegenhoudtdegoedeclipsover.alsjezoals hiereenopnamehebtvantweesurferskanjebijvoorbeeldhetstukdatdecamera zwenkttussendesurferseruitsnijden.jezetindeviewereenin en uitpuntvoorhet fragmentdatjewilhouden.jegaatnunaarhetmodify subclipdienuindebrowserverschijntkanjeeennieuwenaamgeven,zoalshier wipe out. Zomaakjebetertemanagenclips,bijvoorbeeldalsjeeenstoryboardbinnenje montageprogrammamaakt.jekiestvoormediumiconenindebrowserenkannude clipsindegoedevolgordezettenvoordatjegaat monteren. Ini tuneskanjeonderdeadvanced settings ImportUsingopAIFFzettenendesamplerateop48.000kHz,16bitstereo.Jeselecteert detracksini tunesdiejewilgebruikenen kliktopadvancedselection>createaiff Version. Vanuitdemuziekbibliotheekkanje(Ctr+klik) inhetuitrolmenukiezenvoor showinfinder; JekuntdefilenuinFCEimporterenmet ExportFCE. Zoekmetdescrubtoolinde toolbaronderhet vergrootglashetgoede beeldzoeken: Markersonderhetmarkmenuenindeviewerenhetcanvaskanjegebruikenom belangrijkepuntentemarkeren,bijvoorbeeldwaarjelatereentekstoflogowil 4 Kijko.a.op 5 ZieookdetekstCamera en montagevormgeving. 6 Alsereenstoryboardis,isheteenhandigemanieromdenodigeclipsteordenen.

5 invoegen.alsjedubbelkliktopdemarkerkanjenotitiestoevoegen,zodatjelaterziet watjeopdeplekwiltdoen. Ruwe montage: clips inkorten:meteenconventionele drie punt edit kanjemakkelijk jeclipstrimmen.jelaatjeeersteclipuithetstoryboardindeviewerdoorer2xopte klikken. Metje J (=terugspoelen), K (=stoppen) en L toetsen(vooruit)navigeerjedoordeclip omjein en uitpunttekiezen;dei toetsvoorinendeo toetsvoorout(jekuntookdein enuitpuntknopgebruiken:zieafbeeldinglinksonder). Indetijdlijntrekjedespeelkopnaarhet gewensteinpuntensleeptdeclipuitde viewernaarrechts(zoalsjehieronderziet), zethetclipfragmentop overwrite enlaat hetlos.hetzalnuvanzelfbijdeafspeelkopin detijdslijnwordengeplaatst.nukanjehet2 de fragmentindeviewerbewerkenenz.kijk goedwaarjedespeelkopplaatst.ditnoemje eendriepuntsmontage. Iederemontageheefteenritmeenmuziekkandebasisvooreenmontageritmezijn. Muzikale ques kunnenjemontagenatuurlijkermakenenmeerimpactgeven.jekuntin eennieuwesequencebeginnenmeteenmuziekclipindetijdslijn.jesluitdeaudiosporena1ena2linksdooropdehangslotenteklikken,zodatjeernietoverheenkan monteren.jegaatnunaarhet generatormenu onderinhetviewervenster. Jekiest slug datjegebruiktomdeeditsophunplektehoudenals jeopde beat vandemuziekgaatmonteren.(jekandezeclipook ophetnatuurlijkeeb envloedritmevandegolvenmonteren). Sleepdeslugofinsert(F10)metdespeelkopaanhetbeginvande tijdslijnenmaakhemnetzolangalsdemuziekclip. Eenbeetjemuzikaliteithelptomdequesteherkennen,waaropjedeedits(ctrl+v)in real timekanmaken,terwijljenaardemuziekluistert.drukopdeopvallendeslagenin demaatopdetoetsen(ctrl+v),waarjenurodetekensenlassenindeslugziet.nukan jedoorclipfragmentenop replaceedit teslepenterwijldespeelkopinhetmiddenvan deeersteslugclipindetijdslijnstaat,deslugmetjestoryboardfragmentenverruilen.ze nemenvanzelfdelengtevandeslugaan,tenzijzetekortzijn(dankrijgjeeen errormelding).zogajedoortotdehelesequenceisingevuldendaarnakanjede trimtoolsgebruikenomdefragmentenscherpopdebeattemonteren.

6 Eenanderpraktischedriepunt editisbacktiming,datzoveelbetekentalsdatheteind vandeclipbelangrijkerisdanhetbegin.eenvideoclipdieprecieseindigtalsdemuziek uitfadetomheteennatuurlijkeindtegeven,iseengoedvoorbeeld. Jeplaatstjelaatsteclipfragmentindetijdslijnenplaatstaanheteindeencrossdisolveop declip,diehetbeeldlangzaamlaatuitfaden.nuzoekjeeenmuziekclip,diejewil gebruikenenkliktopdeaudiotabindeviewerzodatjede waveform ziet.jekannuaan heteindvandemuziekeenuitpuntplaatsenindeviewerenindetijdlijnbijheteinden beginvandeclipeenuit eninpunt.jehebtweerdriepunten,waarophet muziekfragmentkannavigeren.jamaaktdeoverwrite edit(f10)enluistertofhetgoed is 7.DeshortcutF9gebruikjevooreeninsertedit,dieopdeplekvandeafspeelkop tussendeclipswordtgevoegd 8. Jekuntnueenclipdietochnietgoedwerktvanplekveranderenindetijdlijndoorde selectietoolteactiverenendeclipd.m.v.klik sleep teverplaatsennaardeplekwaarje hemwilhebben;alsjedeoption toetsindruktziejede swappijl enkanjedeclip plaatsen: Jekuntdeclipsallekantenop verplaatsenopdezemanier. De snapknop rechtsboveninde tijdlijn,diejeuitenaankanzetten,zal defragmentenmagnetischtegen elkaaraanklikken.probeerheteens! Trimmen gebruikjeomjemontagetepolijsten.doordubbelopeenclipindetijdlijnte klikkenkanjeindeviewerzienofergenoeghandvattenzijnomdecliptemanipuleren. Voordatjegaattrimmen,kanjebeterdemagnetische snaptoets uitzetten(=grijs). Ripp enrolltools zijngoedomdecliplengteteveranderenende slip enslidetools als jeditnietwil.jekanzebijv.gebruikenomdelassenvanjemuziekclippreciesscherpop deslagenindemuziektekrijgen.jekliktlinksonderindetijdlijnophetpop upmenu: KiesShow Audio Waveforms omdeuitslagen/ hogepiekeninhetgeluidgoedtekunnenzien. Metderoll edit(r)kanjenudelasvanhetvideofragmentpreciesopdeslagmonteren. 7 Gooidenietgebruikteclipsnietmeteenweg,maarmaakeennieuwebinmetrestclips. Pasalsjezekerbentdatjeklaarbent,kanjederestclipsdeleten.Jectrl kliktinde browseropdeclipenkiest revealinfinder omdeorigineleclipopjeharddrivete lokaliserenendeletehemdaar. 8 zorgdatjeindemac voorkeuren(toetsenbordenmuis)def9(allevensters)&f10 (programmavensters)uitgezethebt.

7 Metripple edit(rr)kanjeeenkortfragment verlengen;hieronderheefthetookdefunctieomde videotrackevenlangalsdemuziektracktemaken. enz. Looptdesequencenugoedofhaperternogietsinhetritme?Alsjejeeditpuntenopde juisteplaatshebt,kanjemetdesliptooldebesteactiesbinnenjeclipszoeken.kliksin detijdlijnomdesliptoolteactiveren.alsjeveelactiesinjeshotshebt,kanjejeafvragen hebtaleenglobaalidee,maarkannuheelpreciestewerkgaan.alsjeindetijdlijndoor declipslipt,ziejeindecanvashetin en uitpunttegelijkverschuiven.bedenkwatjemet eenshotwilenhoejehetwillatenaansluitenopdeandereclips.deslidetool(ss)kanje nutotslotgebruikenalsernogeditszijn,dienietopdejuisteplekstaan.detool verschuiftdeclipalsgeheelenpastdenaastliggendeclipsaan. Jekanookeeneditpuntinrealtimemakenalsjeinhet trimedit venster, datjekan activerendoorindetijdlijn2xopeenlasteklikken,dedynamicknopaanklikt.alsboven hetvenstereengroenebaanligt,ishetvensteractief.nukanjeeendynamic editin realtimemaken,doordeclipaftespelenenopdei toetstedrukkenalsdeafspeelkopin detijdlijnophetgoedepeakpuntindemuziekkomt. Hetkanzijndatéénvandeclipsbinnenjesequenceirrelevantisgewordenendatjedie wilvervangen.zorgdatdemuziekclipopslotzit,zodateennieuweclipdeaudioniet kanoverschrijvenenklikfn + deleteomdeirrelevanteclipteverwijderen.jezetde

8 speelkopinhetmiddenvanhetgatensleepteennieuweclipopde replaceoverlay (blauw)indecanvas.jekuntookdemagnetische snapknop weeractiveren (groen)endeclipoprekkenindetijdlijn.eenandermanierisomdelasvandeopte rekkenclipteactiverendooreropteklikkenendespeelkopinhetgatteplaatsentot waarjedeclipwilrekkenenopdee toetstedrukken(=extendedit).jekanookmet eendriepuntsediteenin ofuitpuntindevieweraangevenomzohetgatbijde afspeelkoptevullen.experimenteermetdezemogelijkhedenomeenmaniertekiezen diejeligt. Erzijnverschillendeoptiesomjevideoenaudioin sync tehoudenzoalshetaanklikken vandegelinkte selectie knopnaastdemagnetische snap knop.mochtjeditvergeten zijnendeclipszijnuitsync,dangevenderodemerkjesindetijdlijnaanhoeveeldeclip uitsyncis.doorctrl+klikophetrodemerkjekanjeuittweeoptieskiezen,namelijk move into sync enslipintosync. Metmoveschuifjedevideo enaudioclipfysiekinsync,terwijljeslipgebruiktalsjede clipmetopzetfysiekuitsynchebtverschoven.jesliptjeaudioin synczonderdatde clipsfysiekverschuiven. De J en L cut wordtveeltoegepastomgeluidoptelatenkomenvoordatjehet bijhorendebeeldziet(j cut) zoalsinbovenstaandeclipomdekijkeralvastdevolgende scènebinnentevoeren,zoalsaanhetbeginnadetitel.del cutdoetprecieshet tegenovergesteldeenlaatdeaudiolangerdoorlopendanhetbeeld.jekansimpelwegde audioopslotdoenendevideoeenstukjeterugschuivenzodatereenl vormontstaat. Hetkanzijndatjeopéénvanjeaudio trackshet niveau wilaanpassen,zoals bijvoorbeeldbijeenvoice overtrackdietezachtisinvergelijkingmetdeandereaudio, bijvoorbeeldeenmuziektrack.deaudiotrackswillenwe 12Dbmetuitslagennaar 6Dbvoorenigedynamiek.Jekanjemuziektrackindeaudiometercontroleren.Alsje zietdat ierondde0dbismetuitslagendaarbovenzalhijvervormenenlelijkestoringen geven.alsjeindetijdlijnmetmeerderaudiokanalenwerkt,kanjeopdeaudioknoplinks ondermeermogelijkheden,zoals mute zien.methetkoptelefoonsymboolkiesjede muziekkanalendiejewilhoren.metdeapply normalization gainonderhet modify menu>audio>applynormalizationgain,kanjedekanalenop 12Dbinstellen, zodatdeaudioinevenwichtismetdevoice over.linksonderkanjedewaveform activerenenziendatdemuzieknogsteedsveelmeerpiekenheeftdandestem.netvoor ennahetspreken,zetjemetoption + klik(pentool)tweepuntenopderozeoverlaylijn dieje3dbnaarbenedenhaalt,terwijljedestem3dbomhooghaalt.nukanjedestem zekergoedhoren.

9 Jekanookmetaudio filters inhetbrowservensterondereffectsjegeluidbijstellen. JehebtAppleAudioUnit filtersenfcefilters.probeereenshetlowshelf effect,doorer opteklikkenofhetopjeaudiokanaalindetijdlijnteslepen.inhetfiltervensterkanje nukeyframesneerzettenenomheteffectaantepassenaanjegeluid.alsjeeenvoiceoverhebtvaniemanddiewas slist,gebruikdandevocaldeesser;bijiemandwaardep teveelnadrukkrijgtkanjededepopperinzetten.jekuntfiltersuithetfiltervensternaar eenbinindesequenceslepenomzelaterweertekunnengebruiken. Alsjedeaudiometverschillendecamera sofaudio apparatuurhebtopgenomen,kan hetgeluidtussenverschillendeclipsnogalverschillenenishetgoedomaanheteindvan jemontageaudio overgangen(transitions)tegebruiken.jekliktopeenlasensluitde videoafomalleendeaudiotebeïnvloeden;metctrl + klikkanjeinhetuitrolmenuvoor Cross Dissolvekiezenzodatjeaudiovancliptotclipmooierinelkaaroverloopt.De Cross disslovewerktookopdevideoclips,maarjekannogveelmeervideo overgangen vindeninheteffectvensterindebrowser.jemoetwelgenoeghandelshebbenaande clipsomdeovergangentekunnentoepassen. EenovergangzoalsbijvoorbeeldDip to Colorkanjeaanpassenenbewaren.Jesleeptde overgangnaardelasindetijdlijnenklikterop.jeziethetvolgendevenster: Inditvensterkanjeo.a.dekleur,lengte,starteneindpuntvandeovergangaanpassen. Jekanmetdeeyedroptooleenkleuruitjeclipkiezenvooreenmooieovergang,ofuit hetkleurenpaletkiezen.jekanstartenofeindigenopdelasenalsheteffectjebevalt, sleepjehethandicoonnaardefavorietenfolderindebrowser.geefheteenbijpassende naamomhetlatertekunnengebruiken. EénvandeleuksteovergangenisdeGradientWipeindeWipefolder,waarmeejezelf eenzwart/wit beeldgebruiktomdeovergangtemaken.sleepgradientwipenaareen overgangenopenheteffectvenster.jezietnueenvierkant[?]waarjezelfeen zwart/wit beeldopkanslependatjezelfmaaktinphotoshopofophetwebgoogelt; Bewaarjegradient wipesineen folder,diejeimporteertinde browser.inheteditorvensterkanje o.a.dezachtheidaanpassenvande overgangtotjetevredenbent. Erzijnveelgoedbruikbareovergangen zoalsdepush Slide,waarbijjederichtingvandeinkomendeclipkanveranderenofde Cross Zoominde3Dsimulatiefolder,waarbijjedehoeveelheidzoomkanbijstellenof

10 een blur aankangeven.probeerzeuit,maarpaszezorgvuldigtoe,wanteenoverdaad aaneffectenkanjesequencekillen. Kleurcorrectie kanbijnaiedereclipverbeteren.bijdetvwordtdekleurverzadiging verhoogd(saturation)omhetbeeldlevendigertemaken.jekandebeeldenook cooler makendoordeverzadigingteverlagenenerietsblauwaantoetevoegen.demeest voorkomendebelichtingsproblemenzijnover enonderbelichtingtijdensdeopnamesof eenfoute witbalans.mochtjevergetenzijndewitbalanstijdensdeopnamenbij veranderendelichtomstandighedenopnieuwintestellen,dankanjeinde kleurcorrectorindelinkercirkelalsnogdebalansproberenbijtestellen.metde eyedropperzoekjeindeclipnaareenpuntdatwitzouhorentezijn,maarhetnietis. Hetmiddelpuntvandecirkelzalnunaasthetcentrumkomenenomdebalansbijte stellenkanjemetdeschuivenheelvoorzichtigbewegenzoalshieronder;ietsmeerwit enmidtonen,ietsminderzwartenietsmeerverzadiging.jekuntnuhetoogjeuitzetten omhetverschiltezien. Omover en/ofonderbelichtingaantepassen,sleepjede kleurcorrectorfilter inde kleurcorrectiemapnaardetelichte/donkereclip.dubbelklikomdefiltereditoronderde kleurcorrectertabindeviewerteactiveren 9. Indehue cirkelkanjeaanpassingen makenindekleurtemperatuuromglobale veranderingindeclipstebewerkstelligen. Metdeschuivenbenedenkanjedewit, mid,zwarttonenensaturationbijstellen. Deknoppenrechtszijnvoorautomatische witbalanswaardenenautocontrastvoor zwartwaarden.metsubtielekleurcorrectie inclipsmeteenafwijkendekleurkanjede continuïteitvandehelesequence verhogen,zoalsmetdeeyedropper om huidskleurinverschillendeshotsbeterop elkaartelatenaansluiten. Ofjenuexporteertvoorhetwebofdvdennietomuittezendenoptvishettoch belangrijkommet Broadcast safedekleurenveiligtestellendooreenfilteropdehele sequentietoetepassen.kleuraspectenkunnenbijcompressieenophetweb foutmeldingenveroorzakenenbijvertoningopdetvafgrijselijkebeeldengeven. Selecteertotslotdusalslaatstevoordatjeexporteertjehelesequentiemetcmd + aen pasondereffects > videofilter > kleurcorrectie > broadcast safe toe.jezulthet subtieleverschilnauwelijksopmerken,maarhetisergbelangrijkvoorjekleurkwaliteit! 9 JekuntdescherminstellingopCompositiezettenonderhetvenstermenualsjemeer detailswilzien.

11 RT playback :nietiedereenheefteenlaptopdiealleeffecten in realtimekanterugspelen enzaldusmoetenrenderen.renderenishetproceswaarbijdeeffectenberekenden toegepastwordenzodatjezeinrealtimekanterugzien.bovendetellerindetijdlijnzie jetweestrependieaangevenofrespectievelijkvideoenaudiogerenderdmoeten wordenomeeneffectterugtezien.eendonkergroenekleurbetekenteenrealtimeeffectdatjeniethoeftterenderen,watbijeenrodestreepwelhetgevalis.indebrowse kanjezienwelkeinrealtime(bold)zijnzoals: Compound Blur.Deandereffectenmoeten wordengerenderd.alsjeeenoranjestreepbovendetijdbalkziet,betekentdatdatfce eenbeetjeenergiebespaartendekwaliteitvandeclipverlaagt.zetonderhetrtplaybackmenulinksbovenindetijdlijnterugspeel Video Kwaliteit enframe Rateop dynamicomdehoogsteterugspeelkwaliteittekrijgen.metoption + pkanjefce forcerensommigeeffecten,diegerenderdmoetenwordentochtelatenzien,maarniet inrealtime.jekuntookinhetrt menusafe RTverandereninUnlimited RT,wateen oranjestreepdoetoplichtenbovenheteffect.jekuntnuwelheteffectzien,maarineen minderekwaliteit.uiteindelijkzaljejehelesequencemoetenrenderen;onderhet sequence menukanjeverschillendeoptiesdaarvoorkiezen.zorgervoordatjealle suboptieshebtaangevinktvoordatjetenslottekiestvoorselect all.alsjeveelaudioitemshebtkanjevoordelaatserendering(renderall)eerstkiezenvoorrender only > mixdown audio,datalletrackssamenvoegt;ditkandeaudiokwaliteitverhogen. Mochtjetenslottetochnogniettevredenzijnmetdesequencedankanjenogwat videofiltersgaanuitproberenomdelook and feelteverhogen.behalvedeaanwezige doorsneeblursenwipe effectenzijnerdemeergestileerdeeffectenalsbad tven solarize,maarophetwebkanjeook3 de partijplug insvinden.alsjebijvoorbeeldde Gaussian Blurfilteropjeeerstecliptoepast,ziejemeteenhetresultaatindeviewer.Als jedespeelkopopdegeselecteerdecliphebtstaan,ziejeheteffectinhetcanvasalsjehet filtervensteropentindeviewer.jekuntderadiusverhogenomdetitelingermooi overheentelatenlopenendefilteropéénkleurkanaal,bijvoorbeeldblauw,toepassen. Erzijnvoldoendeeffectenaanwezig,zoalsdeborderfilterwaarmeejegekleurdeborders kantoevoegenofline Art,waarmeejeeensoortgetekendcartooneffectkrijgt.Ophet canvaskanjedegroottevandeclipverminderen,zodatjemeteenwireframe(toetsw) depositiekanveranderenvooreenpicture in pictureeffect.experimenteereensmethet fisheye distort effectdatmeestaltijdenseencameraopnamewordttoegepastmaar waarmeejekleineafwijkingeninhetbeeldkanvervagen.ofprobeerdenieuwe populairegloweffecten, zoalsdebloom en light rays dieveeltoegepastegeavanceerde lichteffectenbewerkstelligen.onderdeimagecontrolefiltersvindjesepia, Desaturate diejeclipzwart/witmaaktentint;d.m.v.keyframeskanjeheteffectlangzaamlaten oplopen. Metmatte filters(bekenduitphotoshop)kanjeuitgespaardeafbeeldingenbovenandere video splaatsen,metperspectieffilterskanje3d bewegingenaanbrengend.m.v. lensflareqt filterzorgtvooreenpopulaireffectenhetqt sharpeneffect kanonscherpe softe beeldenverbeteren. Keyfilterszijnbelangrijkvoorcompositingdatoprelatiefsimpelewijzegeavanceerde effectenkangevendoormeerderevideolagentegebruiken;hetvereistwelenig renderwerk.kiesunlimited RTenschakelde overlays in,zodatjede opacity kan verschuivenomdeclipstransparanttemaken.onderhet modifymenu kanjeinde compositie moduskiezenvoorverschillendeoptiesoverlay,datmetdekleurwaardenvan beideclipswerktenlighten,datdelichtedelenvandeafbeeldingzalaccentueren.

12 Alsjedefoutmelding dropframes krijgtkanjemetcmd + zdemeldinguitschakelen omdathethieralleenomterugspelengaatennietomdefysiekeclip,dienarenderen perfectzallopen. Jekankleurenintensermakendoordezelfdeclipbovenelkaarindetijdlijntezettenen tekiezenvoormodify > composite > multiply. Bijeenonderbelichteclip,diejeboven elkaarindetijdlijnplaatst,selecteerjedebovensteenkiestmodify > composite > screen, datervoorzorgtdatdelichtdelenvandebovensteclipwordengeaccentueerd,watde onderbelichtingdoetafnemen.totsloteeneffectwaarbijjemetcompositedekleurvan jegehelesequentiekanaanpassen.ganaardeslug generatorrechtsonderindeviewer enkiescolormatte:veranderdekleuronderdecontrole tabindeviewerenplaatsde matteineenbovenliggendvideokanaal.kiesnumodify > composite > softlight. Jekunt detintmetde overlay nogaanpassentothetvoldoetaanjesmaak. Incompositiesmeteen greenscreenofbluescreenverwisseljedeachtergronddooreen anderbeeld;ditnoemjekeying (inhollywoodeenberoepopzich).fceenpekunnen eenredelijkekwaliteitkeying bewerkstelligenalsjepreciestewerkgaatentijdensde opnamendeachtergrondenjesubjectgoedbelichtzonderschaduweffecten.depersoon moetminstenseenmetervanhetstrakkegladdescherm(geenrimpelsofkreuken)af zittenofstaanzodatergeengroenspillichtophetsubjectreflecteert.jekrijgtdieptein jebeelddoornogeenextralampophetschermzelftelatenschijnen. Opdracht:dubbelklikophetgreenscreenshotomhetindeviewerteladen. KiesindebrowserondereffectsVideofilter > Key > Color smoothing 4:2:2ensleephet naarde(hdv)videoclip 10.Defilterhelptdekarteligerandenrondonssubjectbijhet toepassenvandekeyteverzachten.sleepdechroma keyerfilternaardeclipenalsjenog eengroenerandlangsjesubjectziet,openjedechroma Keyer Tabindeviewerom aanpassingentemaken.keyingiseennauwkeurigproceswaarbijjegeduldmoet oefenenomdathetomveelaanpassingenvraagt.zetdeachtergonduitommetde eyedropperdegroenelijnteselecterendiejewilverwijderenrondhetsubject.inde controlermaakjehetgroenevlakietsbreder,zodathetgroengenoegverdwijnt: Desaturatie enlumaschuivenwerken hetzelfde;detopknoppenlatenjeeen hogereverzadigingselecterenende onderknoppenregelendetolerantie. WekunnenonderinhetvensterdeEdge Thin slidereenheelkleinbeetjenaarrechts schuivenomdegroenerandteverwijderen enverhoogdesofteningomheteffect vloeiendertemaken.deknoponderde eyedropperisdeview final matte source. Jekanermeecontrolerenofjefinal keyin demattediejeeenwittekey(toon)geeft meteenzwarte invertknop erondergeeftjehetsubjectinzwarttegeneengroeneachtergrondzodatjeheteffect 10 Gebruik4:2:2voorPALmini dvendvcam(voorntscgebruikje4:1:1).

13 nogkanperfectioneren.alsjenudesequencerendert,ziejedeeenvoudigemaar effectievekey: Lastbutnotleastis titels & creditsmakenineenbovenliggendvideospoormakkelijk: 11 Crawlloopalseenneonnieuwsbanddoorjetekst;jezietzewelonderinhettvbeeldlangslopenmetdeuitslagenvanvoetbalwedstrijdenbijvoorbeeld. Lower thirdsziejesomslinksonderinbeeldtijdensinterviews,waardepersoon oflocatiewordtgeïdentificeerd. Outlinetekstziejeo.a.alsvertalingonderinbeeldbijspeelfilmsofinterviews. Scrollingtekstziejebijaftitelingvantelevisieprogramma senspeelfilms. 12 Metdegewonetekstoptie maakjegrotetitelsvoorjevideoproject. Detypewriter geeftletternalettergeanimeerdetekst. Zetdetitelsafeknopenhetwireframeaan,zodatjejetekstkanverplaatsenzonderhem buitenbeeldtelatenvallen.indecontroletabkanjelettertype,grootte,kleur,tracking enz.kiezen.kieseenlichtekleuropeendonkereachtergrondenviceversa.tekstdie kleinerisdan24ismoeilijktelezenoptv;dikkereletterswerkenbeterdandunneen trackdeletterseenbeetjeuitelkaarofverhoogdeopacity waardeomzeduidelijkerte maken.jekanbijlower thirdvooreenachtergrondkleurkiezenenhetvlak croppen en detransparantieinstellen.experimenteermetdesettingsensleepjeeffectnaarde browseralsjeertevredenoverbent,zodatjehemvakerkangebruikenalseentemplate. Metkeyframeskanjetekstopeentijdlijnanimerenofhetmeesttoegepasteteksteffect dropshadow meegeven;jevindtdeschaduwonderdemotiontab.houaltijdingedachte datleesbaarheid debelangrijkstefunctievantekstis 13. Importeren van Photoshopfilesiseenonontbeerlijkehandelingombijvoorbeeld logo stoetevoegen.bewaarjephotoshopfilesals.png(diejefilecomprimeerttotéén laag)zodatjemontageprogrammadeeffectlayersherkentensluiteenalphakanaalin omzebovenvideotekunnenplaatsen.alsjelossephotoshoplayerswilbewerkenmoet jekiezenvooreen.psd file,datdeonafhankelijkelayersintactlaat(hierkanjeaardige animatiesmeemakenindetijdlijn). 11 Alletoolskanjevindeninhetgeneratormenuindeviewer. 12 Hettoevoegenvandeasterix*inhettekstvlakopdeteksttabgeefteengoederuimte tussendenamenbijaftiteling. 13 LIVETYPEgeeftjetoegangtotfancygeanimeerdeteksteffectenalsstring;vergeetniet projectpropertiesoppal 5:4tezettenenbijField dominancevoorhetvoordv gebruikelijkelower (Even)tekiezen.ExporteerjefileomhetinFCEteimporteren.

14 Isdevideonuhelemaalgoedentotslotnogeenkeergerenderdmetalleopties aangevinkt,danishettijdomdevideogereedtemakenvoorexportnaar dvd, tape, web, i pod of mobiel. Zet in en uitpunten bij begin en eind van de sequence en kies File > Export > Quick Timemovie omhetinjevideo folderopteslaan.zorgdataudio envideofiles wordengeëxporteerdineen selfcontainedmovie. Openjedvd programmaalshet nodigisenkieseenthemaomeenmenuaantemaken.sleepjevideoinde dropzone en maakeenplayknop.importeerjestoryboardsalsdiashowengeefzeeengoedetitel. Andereproces docuskanjeookimporteren.alsjeeencomplexmenuwilmakenmet meerderevideo sendiashowsknoppen,kiesdanvoortitle safe. Hetisverstandigomjemastervideooptapetezettenvooreenreservearchief.Jekan60 minutendv videooptapezetten,watongeveer12gbopeenharddriveis.voordatjeje videooptapezet,moetjekijkenofjebijsetupdejuisteinstellingenhebt.zeteenin en uitpuntenopenprint to VideoonderhetFilemenu.Jekuntinstellenwatjevoorennaje sequencewilopnemen,watbijv.voortv werkbelangrijkis.voorbroadcastingwilje15 secondeneencolorbar(kleurenbalk)hebbenvoorcalibratiegevolgddoor10seconden zwart.jekandevideolatenloopenmetzwartertussen.laatdeautomatischerecording aanstaan,zodatexternecamera sofdecksautomatischstarten. QT conversiekanjegebruikenomjevideogeschikttemakenvoorhetweb.kiesonder File>Quicktime>QT conversie.inhetusepop upmenukiesjeeenpresetvoorhet typecodeczoalsdeh.264(broadband High)voordegenenmeteensnelleconnectie. Omaandeveiligekanttezitten(afhankelijkvanjedoelgroep)wiljemisschienmedium oflow.bijeenoptiealsdial up wordtdekwaliteitbedenkelijk,maarhetkanineen enkelgevalsomsnodigzijn.gebruikalleendestreamingoptiesalsjeeenspecifieke webservergebruiktvooronlinedistributie.opennuonderdeoption settings devideosettings,dienuophetrecenteh.264staatingesteld.alsjedeframerateopcurrentzet wordtdepalframeratevan25fr.persecondegebruikt.onderdesize tabziejede customsettingsvoorpal720x576,maardatisveeltegrootvoorhetweb.kiesietsals 480x360omdedownloadsnelheidteverhogen.Nogeeneenvoudigeexportvoorvideo i pods: veranderonderqt conversie hetformaatin i pods (320x240),geefheteen naamenexporteerhetnaarjemovie folder.alsjeernuopdubbelklikt,wordthet automatischinjei tunesfoldergeopend,vanwaaruitjehetnaarjei podkan exporteren.

adobe Premiére Pro CC?

adobe Premiére Pro CC? Hoe maak je een stopmotion in adobe Premiére Pro CC? MULTIMEDIATECHNOLOGIE OPDRACHT TECHNIEK Academiejaar 2013-2014 Studente: Stefanie Rondelez, 1 GMB Lector: Mevr. Ann Audenaert INHOUDSTAFEL --> Stap

Nadere informatie

Handleiding EasyCap Video adapter:

Handleiding EasyCap Video adapter: Handleiding EasyCap Video adapter: Gefeliciteerd met uw aankoop! U kunt nu al uw oude video banden digitaal opslaan en bewerken. De EasyCAP Video adapter kan hoge kwaliteit video beelden en audio geluid

Nadere informatie

woensdag 10 oktober 2012

woensdag 10 oktober 2012 woensdag 10 oktober 2012 Cameratechniek & Montage 1 Cameratechniek 1.1 Camerainstellingen 1.2 Licht 1.4 Geluid 2 Montage 2.1 Theorie 2.2 Overgangen en effecten 2.3 Geluid en muziek 2.4 Importeren en exporteren

Nadere informatie

FCP Mappenadministratie

FCP Mappenadministratie FCP Mappenadministratie 19 februari 2011 door Paul Robbert Hodde AlphaMotions 1 INHOUD doelstelling inventarisatie organisatie handhaving 2 DOELSTELLING Uitleg geven over een eenduidige methode voor het

Nadere informatie

Optika Zwijndrecht november 2010

Optika Zwijndrecht november 2010 Optika Zwijndrecht november 2010 1 Wat gebeurt er met Digitale Foto s? : Foto s worden getoond in de club (Prima) Enkele worden geprint voor tentoonstelling (Prima) Men kan ze enkel met PC herbebijken

Nadere informatie

Een film op PAL-resolutie

Een film op PAL-resolutie Een film op PAL-resolutie Naast geanimeerde GIF-afbeeldingen voor het web, kan u Photoshop ook gebruiken om filmbeelden en filmanimaties in TV-kwaliteit te produceren. Om vanuit Photoshop films te kunnen

Nadere informatie

Photoshop Tutorial. Gioacchino Brucato 2008-2009 OOG OPERATIE

Photoshop Tutorial. Gioacchino Brucato 2008-2009 OOG OPERATIE Photoshop Tutorial Gioacchino Brucato 2008-2009 OOG OPERATIE 1 Stap 1 Open een foto van een oog We starten met onze afbeelding te openen (file - open). U kan werken met een eigen afbeelding of dezelfde

Nadere informatie

voor stagiares door stagiares

voor stagiares door stagiares voor stagiares door stagiares inhoud 1. Tefeloon nummers 2. instellingen en opslaan Naamgeving en opslaan nieuw project of basis project beeldkrant Projecten en Sequence settings Sequence settings SD Sequence

Nadere informatie

23. Video importeren. 1. Kies File / Import / Video Frames to Layers...

23. Video importeren. 1. Kies File / Import / Video Frames to Layers... 23. Video importeren 1. Kies File / Import / Video Frames to Layers... 2. Om films te kunnen importeren moet Apple Quicktime op je computer geïnstalleerd zijn. U kan enkel de filmformaten importeren die

Nadere informatie


EXPORTEREN UIT FINAL CUT EXPORTEREN UIT FINAL CUT vanuit FCE/FCP naar DVD of YouTube (Gebaseerd op Izzy Video en WORKFLOW - FINAL CUT EXPRESS Maak altijd een full-size ongecomprimeerde versie van de film aan (QuickTime

Nadere informatie


Inhoudsopgave VOORBEREIDING... 3 HANDELINGEN OM DE CAMERA FILMKLAAR TE MAKEN:... 5 OPNAMETECHNIEK... 9 CAMERAVIEW... 11 1 Inhoudsopgave VOORBEREIDING... 3 HANDELINGEN OM DE CAMERA FILMKLAAR TE MAKEN:... 5 OPNAMETECHNIEK... 9 CAMERAVIEW... 11 2 Voorbereiding Voordat je begint met filmen moet er een aantal zaken geregeld

Nadere informatie

DVD s maken met Adobe Premiere Encore

DVD s maken met Adobe Premiere Encore DVD s maken met Adobe Premiere Encore In dit hoofdstukje bekijken we hoe je snel een DVD maakt van een film die is gemonteerd in Adobe Premiere Pro. Voor het aanmaken van het menu gebruiken we even Adobe

Nadere informatie

OPDRACHTKAART. Thema: AV-technieken. Video 7. Capture AV-03-07-01. Voorkennis: Je hebt de opdracht De spotlist afgerond.

OPDRACHTKAART. Thema: AV-technieken. Video 7. Capture AV-03-07-01. Voorkennis: Je hebt de opdracht De spotlist afgerond. OPDRACHTKAART AV-03-07-01 Capture Voorkennis: Je hebt de opdracht De spotlist afgerond. Intro: Na het spotten kun je verder gaan met de post-productie. Deze instructie-opdracht beschrijft hoe je de gespotte

Nadere informatie

After Effects Audition Encore 9. Transparantie, keying, schalen en rotatie Transparantie Keying Schalen Roteren 10. De Export Videofilms exporteren

After Effects Audition Encore 9. Transparantie, keying, schalen en rotatie Transparantie Keying Schalen Roteren 10. De Export Videofilms exporteren Inhoudsopgave Registreer dit e-book! Volg ons op de sociale media Voorwoord: Over dit e-book: maak Adobe Premiere CS6 jezelf snel eigen Inleiding: voorbereidingen De opbouw van de videofilm Het juiste

Nadere informatie

Let op! In Movie Maker 2.6 worden de volgende bestanden ondersteund:.avi,.mpg,.m1v,.mp2,.mp2v,.mpeg,.mpe,.mpv2,.wm,.wmv,.asf.

Let op! In Movie Maker 2.6 worden de volgende bestanden ondersteund:.avi,.mpg,.m1v,.mp2,.mp2v,.mpeg,.mpe,.mpv2,.wm,.wmv,.asf. 1 Aangepaste paragraaf 3.7 Video importeren met Windows Movie Maker 2.6 Bij Windows Vista wordt een zeer gebruiksvriendelijk programma meegeleverd waarmee u video s kunt bewerken: Windows Movie Maker versie

Nadere informatie



Nadere informatie

AVCHD (*) : alweer een nieuw video formaat!

AVCHD (*) : alweer een nieuw video formaat! HAF Ledenavond AVCHD (*) : alweer een nieuw video formaat Marc Krier (*): Audio Video Coding High Definition (Wikipedia) 1 maart 2010 HAF 1 Inhoud 1. Evolutie van de informatie dichtheid 2. Beheer van

Nadere informatie

QUICK GUIDE. MODEL: Sony NEX-FS700. SPECIFICATIES: Videokwaliteit. Frame rate 1920 x 1080 60i, 50i, 30p, 25p, 24p (16:9)

QUICK GUIDE. MODEL: Sony NEX-FS700. SPECIFICATIES: Videokwaliteit. Frame rate 1920 x 1080 60i, 50i, 30p, 25p, 24p (16:9) QUICK GUIDE MODEL: Sony NEX-FS700 SPECIFICATIES: Videokwaliteit HD: MPEG-4 AVC/H.264 (AVCHD) SD: MPEG-2 PS Frame rate 1920 x 1080 60i, 50i, 30p, 25p, 24p (16:9) 1280 x 720 60p, 50p (16:9) Sensorgrootte

Nadere informatie

Basis Live Mode Functies Je kan eenvoudig camerabeelden bekijken in een layout naar keuze. Kies een layout bovenaan het scherm, in de Live Mode.

Basis Live Mode Functies Je kan eenvoudig camerabeelden bekijken in een layout naar keuze. Kies een layout bovenaan het scherm, in de Live Mode. Eindgebruiker Quick Start Guide Overzicht De exacqvision Client software bestaat uit 3 schermen: Live, Search, en Setup. Om in het gewenste scherm te geraken, klik je op het desbetreffende pictogram aan

Nadere informatie


HANDLEIDING WINDOWS MOVIE MAKER Handboek Handleiding CinekidStudio Windows Movie Maker HANDLEIDING WINDOWS MOVIE MAKER VERSIE 2.1 VOOR WINDOWS XP COLOFON Auteurs: Karlijn Naaijkens, Vanessa Pattipeilohy Illustraties: Karlijn Naaijkens,

Nadere informatie

Hoe DVD Video gebruiken in Final Cut Pro X door Peter Bouw

Hoe DVD Video gebruiken in Final Cut Pro X door Peter Bouw Hoe DVD Video gebruiken in Final Cut Pro X door Peter Bouw Overzetten van DVD materiaal in Final Cut Pro X is eenvoudig! Zet uw DVDbeelden om met de gratis applicatie, MPEG Streamclip, door transcoding

Nadere informatie

Portret Bewerkingen.

Portret Bewerkingen. Portret Bewerkingen. Inhoudsopgave: Portret Bewerkingen... 1 Oneffenheden wegwerken... 3 Lichte plekken wegwerken... 5 Licht van de gehele foto aanpassen... 10 De lichte delen aanpassen in de foto... 11

Nadere informatie

Tutorial Adobe Premiere

Tutorial Adobe Premiere Tutorial Adobe Premiere 1999 Fontys Hogeschool Venlo Auteur: Pierre Gorissen Kenmerk: Gor99-AdobePremierev01 Inhoudsopgave Inhoudsopgave...2 Starten met de videoproductie...4 Opstarten van Adobe Premiere

Nadere informatie

OPDRACHTKAART. Thema: AV-technieken. Video 9. Eindmontage AV-03-09-01. Voorkennis: Je hebt de opdracht Basismontage afgerond.

OPDRACHTKAART. Thema: AV-technieken. Video 9. Eindmontage AV-03-09-01. Voorkennis: Je hebt de opdracht Basismontage afgerond. OPDRACHTKAART AV-03-09-01 Eindmontage Voorkennis: Je hebt de opdracht Basismontage afgerond. Intro: Nu de basismontage klaar is, kun je gaan beginnen met de eindmontage. Tijdens deze instructie-opdracht

Nadere informatie

Green screen effect Tutorial

Green screen effect Tutorial Green screen effect Tutorial Green screen of Chromakey (ook wel kleurwaarde of, kleurspecifiek, Bluekey, Bluescreening, Greenkey) is een techniek die vaak wordt gebruikt binnen de filmwereld. Hierbij wordt

Nadere informatie

Converteren van video s

Converteren van video s Converteren van video s Mario Somers Juni 0 In de huidige maatschappij volstaat het niet meer om een videofilm op DV of tape te plaatsen om uit te wisselen met anderen. De evolutie van internet, streaming

Nadere informatie

Fontys Hogescholen - KLC Sittard

Fontys Hogescholen - KLC Sittard LET OP! Als je je bestanden wilt verzekeren tegen verlies, dan dien je zelf back-ups te maken. Het kan namelijk altijd gebeuren dat een harde schijf crasht of andere onvoorziene gebeurtenissen zich voordoen.

Nadere informatie

Vastleggen en monteren in Windows Moviemaker KENNISNET 2006

Vastleggen en monteren in Windows Moviemaker KENNISNET 2006 Vastleggen en monteren in Windows Moviemaker KENNISNET 2006 Inleiding... 3 Camera aansluiten... 5 Video vastleggen... 7 Video importeren... 14 Video bewerken... 15 Overgang maken tussen 2 clips... 17 Video-effecten...

Nadere informatie

GELUIDSBEWERKING. Premieregroep 2009 1 of 5

GELUIDSBEWERKING. Premieregroep 2009 1 of 5 GELUIDSBEWERKING Voor de doorsneefilm, zoals een vakantiefilm, reportage of documentaire zullen we over het algemeen 3 soorten geluid gebruiken, t.w. 1. Livegeluid 2. Voice-over 3. Muziek Dankzij meerdere

Nadere informatie


VIDEOBEWERKEN DEEL 2 VIDEOBEWERKEN DEEL 2 In deel 1 van het videobewerken hebben we het gehad over de instellingen en wat er zoal in de bewerkings omgeving te vinden is In deel twee gaan we film opnemen, plaatsen het in het

Nadere informatie

Video's bewerken met OpenShot

Video's bewerken met OpenShot Video's bewerken met OpenShot Met vrijwel alle fotocamera 's en smartphones kun je ook video opnemen. De kwaliteit van de opname en de resolutie kunnen erg variëren afhankelijk van de camera. De huidige

Nadere informatie

21 oktober 2015. Geheugenkaartjes

21 oktober 2015. Geheugenkaartjes 21 oktober 2015 Geheugenkaartjes Inhoud Inleiding Geheugenkaartjes bij opname Geheugenkaartjes bij montage Geheugenkaartjes voor opslag en transport 2 Inleiding Video-opslag is technologie die nog steeds

Nadere informatie

Monteren van een stop motion filmpje in Adobe Premiere

Monteren van een stop motion filmpje in Adobe Premiere Auteur: Jeroen Thibau OLOD: Multimediatechnologie Academiejaar: 2013-2014 Monteren van een stop motion filmpje in Adobe Premiere Wat willen we bereiken? In deze tutorial ga ik ervan uit dat je alle foto

Nadere informatie

Onderwerp: organisatorische en technische werkwijze lesregistratie

Onderwerp: organisatorische en technische werkwijze lesregistratie Project ICTalogy Onderwerp: organisatorische en technische werkwijze lesregistratie Door: Rutger Dorresteijn, Rasto (ROC Leiden) Versie: 0.2 Datum: 10-07-2007 Organisatorische werkwijze Technische werkwijze

Nadere informatie

Camtasia Studio 4: filmpjes bewerken en video opnemen.

Camtasia Studio 4: filmpjes bewerken en video opnemen. Camtasia Studio 4: filmpjes bewerken en video opnemen. Handleiding van Auteur: dapunt Juli 2007 handleiding: Camtasia Studio 4: filmpjes bewerken en video opnemen. Camtasia Studio 4: filmpjes bewerken

Nadere informatie

Handleiding. Garageband imovie

Handleiding. Garageband imovie Handleiding Garageband imovie Inhoud Garageband 3 Garageband: een project aanmaken 3 Garageband: maken van geluidsspoor 3 Garageband: opnemen voice-over 4 Garageband: geluidsopname exporteren 4 imovie

Nadere informatie

FCP X: Maak een Split Edit

FCP X: Maak een Split Edit FCP X: Maak een Split Edit Een split edit is een edit waar de audio en video overgang (verandert) op verschillende tijden in de Tijdlijn In dit artikel. wil ik uitleggen wat split edits zijn, tonen hoe

Nadere informatie

- 2 - Copyright H. Boonstra Computer Plus Club, 25 januari 2010 (versie 16.5)

- 2 - Copyright H. Boonstra Computer Plus Club, 25 januari 2010 (versie 16.5) Inhoud: 1 Inleiding... 6 2 Hard / Software specificatie... 7 2.1 Installatie Cursusmateriaal...8 3 Start programma.... 9 3.1 Snelkoppeling...9 3.2 Start programma d.m.v. Start / Alle programma s...9

Nadere informatie

Fijn videobewerken. Ulead VideoStudio 7 SE Basic

Fijn videobewerken. Ulead VideoStudio 7 SE Basic _Videostudio.qxd 31-08-2005 14:08 Pagina 40 PRAKTIJK Ulead VideoStudio 7 SE Basic Fijn videobewerken Net terug van vakantie? Grote kans dat er dan veel beeldmateriaal op je camcorder staat waarmee je nog

Nadere informatie

OPDRACHTKAART. Thema: AV-technieken. Video 8. Basismontage AV-03-08-01. Voorkennis: Je hebt de opdracht Capture afgerond.

OPDRACHTKAART. Thema: AV-technieken. Video 8. Basismontage AV-03-08-01. Voorkennis: Je hebt de opdracht Capture afgerond. OPDRACHTKAART AV-03-08-01 Basismontage Voorkennis: Je hebt de opdracht Capture afgerond. Intro: Nu alle videofragmenten gecaptured zijn, kun je gaan beginnen met de montage. De totale montage bestaat uit

Nadere informatie

Geheugenkaartjes. 19 december 2014

Geheugenkaartjes. 19 december 2014 Geheugenkaartjes 19 december 2014 Inhoud Inleiding Geheugenkaartjes bij opname Geheugenkaartjes bij montage Geheugenkaartjes voor opslag en transport 2 Inleiding Video-opslag is technologie die nog steeds

Nadere informatie

Stroomlijn van handelingen binnen Windows movie maker

Stroomlijn van handelingen binnen Windows movie maker . Voorbereiding: 1. Je kunt op meerdere manieren beelden overzetten: a. Sluit je video- of fotocamera aan op de pc (eventueel via een laadstation) b. Sluit een kaartlezer met de geheugenkaart van je camera

Nadere informatie

Basis Monteertechniek. Pinnacle Studio 10

Basis Monteertechniek. Pinnacle Studio 10 Basis Monteertechniek Pinnacle Studio 10 December 2008 Inhoudsopgave Inleiding 3 1 Beginnen met werken 4 1.1 Harddisk camera aansluiten aan de computer 4 1.2 Camera met DV-tape aansluiten aan de computer

Nadere informatie

Film in de pc laden.

Film in de pc laden. Film in de pc laden. Wat is er nodig: De hardeschijf moet voldoende ruimte hebben om het ruwe beeldmateriaal te kunnen bewerken en te bewaren. 1 uur digitale video= 3600 sec. X 3,6 MB/sec.= 12.960 MB =

Nadere informatie

1 Inleiding 1 / 18. DATUM UITGIFTE : DATUM HERZIENING : Gebruikershandleiding ivms-4200-client 2.3 HIKVISION

1 Inleiding 1 / 18. DATUM UITGIFTE : DATUM HERZIENING : Gebruikershandleiding ivms-4200-client 2.3 HIKVISION 1 / 18 1 Inleiding Deze verkorte handleiding beschrijft de meest gebruikte mogelijkheden voor het live bekijken van beelden, evenals het opvragen van opgenomen beelden. Mochten er vragen, opmerkingen of

Nadere informatie

#04: Klik met rechter muisknop in het wit tussen de bestanden en kies met linker Alles selecteren

#04: Klik met rechter muisknop in het wit tussen de bestanden en kies met linker Alles selecteren XP...Workshop Movie Maker Deel 1 Filmpje maken van foto s: Moviemaker is een gratis programma van MS en zit in elke computer bij de programma s... Alle studie materieaal zit bij het CCBS in de map Mijn

Nadere informatie

Online videobewerking: 1. Offline vs. Online

Online videobewerking: 1. Offline vs. Online Online videobewerking: 1. Offline vs. Online... 1 2. WeVideo... 2 2.1. Inloggen... 2 2.2. Een nieuw project starten... 3 2.3. Media Importeren... 5 2.4. OPDRACHT... 7 2.5. Publiceren... 8 BIJLAGE: Videobestanden

Nadere informatie

Informatie voor de Final Cut groep,

Informatie voor de Final Cut groep, Informatie voor de Final Cut groep, door Peter Bouw. op zaterdag 1 mei 2010, en zaterdag 22-1-2011 in Schoonhoven: Ik heb de genomen stappen op papier gezet, om voor ieder die het niet begreep of niet

Nadere informatie

deze les: settings en codecs editing camera-instellingen cameravoering audio opnemen en gebruiken oefening en opdracht 3

deze les: settings en codecs editing camera-instellingen cameravoering audio opnemen en gebruiken oefening en opdracht 3 deze les: settings en codecs editing camera-instellingen cameravoering audio opnemen en gebruiken oefening en opdracht 3 settings en formats registreren/importeren/exporteren rec format: op deze camera:

Nadere informatie

Windows Moviemaker. 1. Waar te vinden? Taal in een ELO: Bijlage 3 p. 1

Windows Moviemaker. 1. Waar te vinden? Taal in een ELO: Bijlage 3 p. 1 Taal in een ELO: Bijlage 3 p. 1 Windows Moviemaker 1. Waar te vinden?... 1 2. Stap 1: Elementen op de regietafel leggen... 2 3. Stap 2: Samenstellen... 3 4. Stap 3: Bewerken... 3 4.1. Video effect weergeven....

Nadere informatie

Praktijk voorbeeld 2: midi opnemen

Praktijk voorbeeld 2: midi opnemen ' Bij dit praktijkvoorbeeld leer je hoe je midi informatie kunt opnemen in Sonar. Aan bod komt ondermeer: - de metronoom - Midi sporen opnemen - Loop recording - punch in en punch out Nieuw Project: Voordat

Nadere informatie

1 Inleiding 1 / 24. DATUM UITGIFTE : 24-1-2014 DATUM HERZIENING : 18-7-2014 Gebruikershandleiding ivms-4200-client 2.0 HIKVISION

1 Inleiding 1 / 24. DATUM UITGIFTE : 24-1-2014 DATUM HERZIENING : 18-7-2014 Gebruikershandleiding ivms-4200-client 2.0 HIKVISION 1 / 24 1 Inleiding Deze verkorte handleiding beschrijft de meest gebruikte mogelijkheden voor het live bekijken van beelden, evenals het opvragen van opgenomen beelden. Mochten er vragen, opmerkingen of

Nadere informatie

Product introductie Video deluxe 16. Presentatie: Fred van Eck

Product introductie Video deluxe 16. Presentatie: Fred van Eck Product introductie Video deluxe 16 Presentatie: Fred van Eck De MAGIX editing line-up 2 2 MAGIX Video deluxe 16 Voor beginners en willekeurige gebruikers Highlights in Video deluxe 16? Full HDV support:

Nadere informatie

4. Video s maken met Windows Movie Maker 1

4. Video s maken met Windows Movie Maker 1 101 4. Video s maken met Windows Movie Maker 1 Het bewerken van video s op de computer wordt steeds populairder. Het probleem is dat u daar vaak een duur, speciaal videobewerkingsprogramma voor nodig heeft.

Nadere informatie

Verkorte Mediabrowser 2 Gebruiksaanwijzing-stappenplan

Verkorte Mediabrowser 2 Gebruiksaanwijzing-stappenplan Verkorte Mediabrowser 2 Gebruiksaanwijzing-stappenplan Kies C voor een complete DVD montage Schuin gedrukte tekst kan eventueel worden overgeslagen (titels, effecten of achtergrondmuziek zijn niet mogelijk)

Nadere informatie

Audition Encore 9. Transparantie, keying, schalen en rotatie Transparantie Keying Schalen Roteren 10. De Export Videofilms exporteren Foto s

Audition Encore 9. Transparantie, keying, schalen en rotatie Transparantie Keying Schalen Roteren 10. De Export Videofilms exporteren Foto s Inhoudsopgave Registreer dit e-book! Volg ons op de sociale media Voorwoord: maak Adobe Premiere CS6 jezelf snel eigen Inleiding: voorbereidingen De opbouw van de videofilm Het juiste montagesysteem 1.

Nadere informatie

1. Exporteren... 2. 2. Verschil Xls en Csv... 2. 3. Het maken van een Csv bestand... 4. 4. Sorteren in Excel 2003... 9. 5. Sorteren in Excel 2007...

1. Exporteren... 2. 2. Verschil Xls en Csv... 2. 3. Het maken van een Csv bestand... 4. 4. Sorteren in Excel 2003... 9. 5. Sorteren in Excel 2007... ESIS en Excel 2003 en 2007 Inhoud 1. Exporteren... 2 2. Verschil Xls en Csv... 2 3. Het maken van een Csv bestand... 4 4. Sorteren in Excel 2003... 9 5. Sorteren in Excel 2007...10 6. Filteren in Excel

Nadere informatie

Beweging van a naar b Beweging van groot naar klein.

Beweging van a naar b Beweging van groot naar klein. 1 2 2014 Algemeen. In de film wordt veel gebruik gemaakt van wordt bijna geen film meer gemaakt zonder special effects en animatie. Soms is het een bescheiden onderdeel en soms staat een film

Nadere informatie

Videobewerking. Met Adobe Première Pro CS3. De Vos Philip & Raes Bert

Videobewerking. Met Adobe Première Pro CS3. De Vos Philip & Raes Bert Videobewerking Met Adobe Première Pro CS3 De Vos Philip & Raes Bert 1 Inhoudstafel 1 Inhoudstafel... 2 2 Voorwoord... 7 3 Een nieuw project... 8 4 Werkscherm... 9 4.1 Clip importeren... 10 5 MONTEREN...

Nadere informatie

#01: #02: #03: Clips maken van video bestanden #04: Importeren #05: #06: Plusje

#01: #02: #03: Clips maken van video bestanden #04: Importeren #05: #06: Plusje XP...Workshop Movie Maker Deel 2 Geimporteeerde video s bewerken met Moviemaker dat is een gratis programma van MS en zit in elke computer bij de programma s... Alle studie materieaal zit bij de CCBS in

Nadere informatie

Eenvoudig overstappen naar Windows 7 (ik heb Windows Vista)

Eenvoudig overstappen naar Windows 7 (ik heb Windows Vista) Eenvoudig overstappen naar Windows 7 (ik heb Windows Vista) Werk je met Windows Vista? Je kunt eenvoudig een upgrade naar Windows 7 uitvoeren. Bij een upgrade blijven de bestaande gegevens en programma

Nadere informatie

Cupsong Videoclip. Handleiding. Link in de Kabel vzw. Doelstelling

Cupsong Videoclip. Handleiding. Link in de Kabel vzw. Doelstelling Handleiding Cupsong Videoclip 1 Leeftijd +10 Duur Auteur Doelstelling Onderwerp Benodigd materiaal Minstens 1u30 à 2u per onderdeel Tessa Goossens De jongeren bedenken en voeren zelf een idee uit. Ze leren

Nadere informatie

Foto- en digitale media

Foto- en digitale media Prijslijsten Nieuwe Media Dienst, UA, 2006 prijzen intern (eigen financiering en studenten) prijzen voor externen (UZA, UBCA en externe facturen): afzonderlijk opvragen Foto- en digitale media prijs beeldbewerking

Nadere informatie

Les 3: Het diagram voor gevorderden

Les 3: Het diagram voor gevorderden Les 3: Het diagram voor gevorderden Aangezien het diagram en het tekstscherm met elkaar zijn verbonden zult u zien dat het diagram is veranderd na uw werk in het tekstscherm. In deze les maakt u uw diagram

Nadere informatie

DVD Ondertitel tutorial

DVD Ondertitel tutorial 1 DVD Ondertitel tutorial Deze tutorial bestaat uit 4 delen. Deze tutorial is enkel bestemd voor de leden van De delen: Deel 1 Ondertitels rippen Deel 2 Ondertitels vertalen Deel 3 Ondertitels terugplaatsen

Nadere informatie

Photoshop CS6. Hand out Les 1 & 2 Bijlage snelfuncties.

Photoshop CS6. Hand out Les 1 & 2 Bijlage snelfuncties. Photoshop CS6 Hand out Les 1 & 2 Bijlage snelfuncties. 1 Downloaden Adobe Photoshop CS6 Om gezamelijk aan de slag te kunnen tijdens de Photoshop lessen, is het nodig om in je eigen tijd de laatste versie

Nadere informatie

Pinnacle studio 14. Workshop

Pinnacle studio 14. Workshop Pinnacle studio 14 Workshop Inhoud De interface... 2 Project... 2 Film samenstellen... 4 Overgangen... 4 Titels... 5 Geluid... 6 Filmfragmenten aanpassen.... 7 Menu s Maken... 9 DVD s Branden... 11 De

Nadere informatie

Voer de bijgeleverde muis in een USB ingang voorop de recorder en controleer of het

Voer de bijgeleverde muis in een USB ingang voorop de recorder en controleer of het 1. Bediening met de muis Voer de bijgeleverde muis in een USB ingang voorop de recorder en controleer of het icoontje in beeld verschijnt. Beweeg uw muis om uw wachtwoord in het keypad in te voeren. Dat

Nadere informatie

15. Vullingen en patronen

15. Vullingen en patronen 15. Vullingen en patronen Met het verfemmertje kan u een selectie of laag opvullen met een bepaalde kleur of met een patroon. Een patroon is een zichzelf herhalend motief waarvan de randen naadloos in

Nadere informatie

Nieuw document aanmaken: File > New..

Nieuw document aanmaken: File > New.. Nieuw document aanmaken: File > New.. Je kan je bestand bovenaan een naam geven. Zorg ook dat je width en height op pixels staan, anders krijg je erg grote bestanden. Resolution zet je op 72 en Pixels/inch.

Nadere informatie

Werken met Movie Maker

Werken met Movie Maker Werken met Movie Maker Auteur: Bart van Turnhout Versie: 3.1 2012-2014, Kenniscenter de Kempel Inhoudsopgave 1. Vooraf... 3 2. Stappenplan... 4 3. Voorbereiding... 5 4. Opnemen en Importeren... 6 5. Bewerken...

Nadere informatie



Nadere informatie


DIGITALE VIDEO MET WINDOWS MOVIE MAKER. H. Foole DIGITALE VIDEO MET WINDOWS MOVIE MAKER H. Foole 1. INHOUDELIJK Een film moet kort en helder laten zien waar het om gaat. De filmopnamen kun je meestal maar één keer maken, bijvoorbeeld als je praktijksituaties

Nadere informatie

HANDLEIDING. Terug zoeken en archiveren met de Mobotix Control Center 2.2

HANDLEIDING. Terug zoeken en archiveren met de Mobotix Control Center 2.2 HANDLEIDING Terug zoeken en archiveren met de Mobotix Control Center 2.2 De event player: Selecteer een camera door het desbetreffende beeld 1 keer aan te klikken met de muis. Rondom het live beeld verschijnt

Nadere informatie

Voor deze tutorial heb je een aantal afbeeldingen nodig. Deze afbeeldingen kan je downloaden via de site maureensphotoshoptutorials.wordpress.

Voor deze tutorial heb je een aantal afbeeldingen nodig. Deze afbeeldingen kan je downloaden via de site maureensphotoshoptutorials.wordpress. Voor deze tutorial heb je een aantal afbeeldingen nodig. Deze afbeeldingen kan je downloaden via de site Zodra de bestanden gedownload zijn kan je beginnen. Veel

Nadere informatie

Keyframes. Final Cut Fans presentatie. Rob Trietsch

Keyframes. Final Cut Fans presentatie. Rob Trietsch Final Cut Fans presentatie Rob Trietsch 5 juli 2014 Inhoudsopgave Keyframes 1 Keyframes 2 1.1 Wat zijn keyframes? 2 1.2 Waar kun je keyframes instellen? 2 1.3 Wat kun je WEL en wat kun je NIET met een

Nadere informatie


WERKEN MET TEKST in ILLUSTRATOR WERKEN MET TEKST in ILLUSTRATOR Tekst speelt een grote rol als design in illustraties en opmaak. Net zoals andere objecten kun je tekst een kleur geven, schalen, roteren... vervormen. In Illustrator kan

Nadere informatie

1. Exporteren... 2. 2. Verschil Xls en Csv... 2. 3. Het maken van een Csv bestand... 4. 4. Sorteren...10. 5. Filteren...11

1. Exporteren... 2. 2. Verschil Xls en Csv... 2. 3. Het maken van een Csv bestand... 4. 4. Sorteren...10. 5. Filteren...11 10 Afdrukken & Exports ESIS WEBBASED webbased en Excel 2007 Inhoud 1. Exporteren... 2 2. Verschil Xls en Csv... 2 3. Het maken van een Csv bestand.... 4 4. Sorteren...10 5. Filteren...11 6. Kolommen en

Nadere informatie

Initiatie Movie Maker

Initiatie Movie Maker Initiatie Movie Maker Wat is Movie Maker? Windows Movie Maker is een computerprogramma dat toelaat video-bestanden te bewerken. Het wordt standaard bij de besturingssystemen Windows XP, Windows ME en Windows

Nadere informatie

Beknopte handleiding AVC792 Nederlands. 9. Vraag en antwoord voor de meest voorkomende problemen

Beknopte handleiding AVC792 Nederlands. 9. Vraag en antwoord voor de meest voorkomende problemen Beknopte handleiding AVC792 Nederlands 1. Live beeld 2. Ontgrendelden en vergrendelen 3. Opbouw van het menu 4. Terugkijken (bediening via de recorder) 5. Zoeken via het menu 6. Backup 7. Veranderen van

Nadere informatie

We geven hier weer waar u wat vindt op de CD, voor het gebruik thuis.

We geven hier weer waar u wat vindt op de CD, voor het gebruik thuis. PC-Radio Express thuis Bij veel PC-Radio gebruikers bestaat de wens om ook thuis met het systeem aan de slag te gaan. Het is prettig als de databank eens geraadpleegd kan worden, bijvoorbeeld om te controleren

Nadere informatie

PRO 4000. NOORD 137 2931 SJ KRIMPEN a/d LEK TELEFOON: 0180593913 FAX: 0180593266 INTERNET: WWW.PRO-REC.NL

PRO 4000. NOORD 137 2931 SJ KRIMPEN a/d LEK TELEFOON: 0180593913 FAX: 0180593266 INTERNET: WWW.PRO-REC.NL PRO 4000 NOORD 137 2931 SJ KRIMPEN a/d LEK TELEFOON: 0180593913 FAX: 0180593266 INTERNET: WWW.PRO-REC.NL 1 1.0 BELANGRIJKE EIGENSCHAPPEN VAN HET PRO 4000 SYSTEEM - H.264 compressie techniek full D1 - Volledig

Nadere informatie

+ + Casablanca S-6000 - Speciale aanbiedingen. (geldig van 5 september - 4 oktober 2012) Aanbieding 1-2749. Aanbieding 2-2879

+ + Casablanca S-6000 - Speciale aanbiedingen. (geldig van 5 september - 4 oktober 2012) Aanbieding 1-2749. Aanbieding 2-2879 Casablanca S-6000 - Speciale aanbiedingen (geldig van 5 september - 4 oktober 2012) Aanbieding 1-2749 De combinatie van een Casablanca S-6000 en de RenderBooster kost normaal 3168. Bij deze aanbieding

Nadere informatie

Stap 2: Maak een kleurlaag (vaste kleur/solid color) onder je afbeelding

Stap 2: Maak een kleurlaag (vaste kleur/solid color) onder je afbeelding Stap 1: Open je foto in Photoshop: Tip: als je geen venster met lagen/layers ziet: druk op F7 Stap 2: Maak een kleurlaag (vaste kleur/solid color) onder je afbeelding Hiervoor moet je eerst de achtergrond-laag

Nadere informatie

Explain Everything. Startscherm. toevoegen nieuw project. toevoegen nieuw project, startend vanuit gekozen afbeelding of ander bestand

Explain Everything. Startscherm. toevoegen nieuw project. toevoegen nieuw project, startend vanuit gekozen afbeelding of ander bestand Explain Everything Startscherm toevoegen nieuw project toevoegen nieuw project, startend vanuit gekozen afbeelding of ander bestand project selecteren en exporteren instellingen en voorkeuren informatie

Nadere informatie

PICASA PICASA. FOTOBEWERKING Een handleiding. 2013 Computertraining voor 50-plussers

PICASA PICASA. FOTOBEWERKING Een handleiding. 2013 Computertraining voor 50-plussers PICASA FOTOBEWERKING Een handleiding 2013 Computertraining voor 50-plussers PC50plus computertrainingen Eikbosserweg 52 1214AK Hilversum tel: 035 6213701 PICASA C O M P

Nadere informatie

ApS-Ethos. Innovator Artisan Plus / Virtuoso Release Notes voor Versie X4 (14.0)

ApS-Ethos. Innovator Artisan Plus / Virtuoso Release Notes voor Versie X4 (14.0) ApS-Ethos Innovator Artisan Plus / Virtuoso Release Notes voor Versie X4 (14.0) Versie 14 Release Notes Algemen tools Stitch Protection / Steken bescherming: In versie X3, is er een tool toegevoegd die

Nadere informatie

Starten met. demoversie. Sibelius 5. Cursusboek. frans frijns

Starten met. demoversie. Sibelius 5. Cursusboek. frans frijns Starten met Sibelius 5 Cursusboek frans frijns Inhoudsopgave Sibelius 5 Installeren Sibelius 5...5 Sound Essentials...6 Scorch...6 Photoscore Lite...6 Basishandelingen Sibelius starten...7 Een partituur

Nadere informatie


Gebruikershandleiding Gebruikershandleiding BDR104 recorder Postbus 218 5150 AE Drunen Thomas Edisonweg 5 5151 DH Drunen HELPDESK : 0900-27274357 Inhoudsopgave 1 Productbeschrijving... 2 2 Aansluitingen...

Nadere informatie

8. VIDEO OUT 9. Bedieningsknoppen 10. POWER indicatie 11. PAL indicatie 12. Kanaalkeuze schakelaar 13. VIDEO IN. PC Transmitter

8. VIDEO OUT 9. Bedieningsknoppen 10. POWER indicatie 11. PAL indicatie 12. Kanaalkeuze schakelaar 13. VIDEO IN. PC Transmitter Product informatie RECEIVER. Antenne 2. VGA OUT 3. VGA IN 4. AUDIO IN 5. S-VIDEO 6. voedingspanning 7. Besturingstoetsen 8. VIDEO OUT 9. Bedieningsknoppen 0. POWER indicatie. PAL indicatie 2. Kanaalkeuze

Nadere informatie

Digitaal vertellen Technische handleiding voor leerlingen

Digitaal vertellen Technische handleiding voor leerlingen Digitaal vertellen Technische handleiding voor leerlingen Handelingen: Mapjes aanmaken Foto s naar pc kopiëren / foto s naam geven Foto s scannen Uitleg Ulead Ulead opstarten Voice-over opnemen Storyboard

Nadere informatie

Verkorte Nederlandse Gebruikershandleiding

Verkorte Nederlandse Gebruikershandleiding Verkorte Nederlandse Gebruikershandleiding 1. Bediening van de DVR 1.1 Bediening met de muis De muis moet aan de ACHTERKANT van de recorder worden aangesloten op de USB ingang. Als de muis actief is dan

Nadere informatie

Inhoudsopgave: Whisper380-computerhulp

Inhoudsopgave: Whisper380-computerhulp Versie: 1.0 Gemaakt door: Whisper380 Eigenaar: whisper380-computerhulp Datum: 27-9-2010 Inhoudsopgave: Inhoudsopgave:... 2 Het programma downloaden:... 3 Het installeren van het programma:... 4 Het programma

Nadere informatie

Wat is er nieuw in Final Cut Pro 10.1.2

Wat is er nieuw in Final Cut Pro 10.1.2 Wat is er nieuw in Final Cut Pro 10.1.2 Vertaling van What s New in Final Cut Pro 10.1.2 door Mark Spencer en Steve Martin (Ripple Training) Inleiding Apple heeft de 12 e update uitgebracht sinds het verschijnen

Nadere informatie

Competenties. Kerntaak 1 - Ontwerpt media-uiting. Kerntaak 1 - Ontwerpt media-uiting

Competenties. Kerntaak 1 - Ontwerpt media-uiting. Kerntaak 1 - Ontwerpt media-uiting Competenties In deze training ga je aan de slag met de volgende Kerntaken, bijbehorende werkprocessen en competenties: Kerntaak 1 - Ontwerpt media-uiting Werkprocessen Competenties 1.3 Maakt concept Onderzoeken

Nadere informatie

Handleiding Dahua recorders (WEB Service) 28-10-2012

Handleiding Dahua recorders (WEB Service) 28-10-2012 Inloggen Open de webservice in uw internetbrowser, bijvoorbeeld: Vul uw gebruikersnaam (User Name) en wachtwoord (Password) in. Klik op Login om in te loggen. Krijgt u geen loginscherm

Nadere informatie

VRT. Bestand gebaseerde aanlevering van afgewerkte programma s in HD DUBBINGS. Praktische Gids

VRT. Bestand gebaseerde aanlevering van afgewerkte programma s in HD DUBBINGS. Praktische Gids VRT Bestand gebaseerde aanlevering van afgewerkte programma s in HD DUBBINGS Praktische Gids 0/0/206 Versie.3 Overzicht Geleverd TEN LAATSTE 0 WERKDAGEN VOOR UITZENDING Toelevering via fiber/internet Videofile

Nadere informatie

SMPTE 377M-2004: Material Exchange Format (MXF) File Format Specification


Nadere informatie

Verkenning Pinnacle Studio 17 Ultimate

Verkenning Pinnacle Studio 17 Ultimate 1 Verkenning Pinnacle Studio 17 Ultimate Vanaf de versie AVID Studio en de daarop volgende Pinnacle Studio 16 was al snel duidelijk dat Pinnacle Studio een metamorfose had ondergaan. Bij het ontwikkelen

Nadere informatie

Handleiding gebruik Cascando OFML data in pcon.planner

Handleiding gebruik Cascando OFML data in pcon.planner Handleiding gebruik Cascando OFML data in pcon.planner In deze handleiding wordt u stapsgewijs wegwijs gemaakt in het gebruik van Cascando OFML data in pcon.planner. 1. Cascando producten openen in pcon.planner

Nadere informatie