Wie? Advanced Databases blok DB vs IR. Wat? Canonical application (DB) Canonical application (DB)

Maat: px
Weergave met pagina beginnen:

Download "Wie? Advanced Databases blok 4 2011. DB vs IR. Wat? Canonical application (DB) Canonical application (DB)"


1 Advanced Databases blok Wie? Hans Philippi: docent/practicumleider René Kersten: assistent bij practicum Hans Philippi 1 2 Wat? DB vs IR 2005 XML (Siebes) 2007 Google ranking (Siebes) 2009/2011 Databases & Information Retrieval verschillen & overeenkomsten en passant: basics IR, DB technologie 3 practicumopgaven 3 canonical application: data type: accounting numbers, short strings foundation: algebraic / logic based search paradigm: market leaders: Boolean retrieval (exact queries, result sets/bags) Oracle, IBM DB2, MS SQL Server libraries text bron: Gerhard Weikum probabilistic / statistics based ranked retrieval (vague queries, result lists) Google, Yahoo!, MSN, 4 Canonical application (DB) Nuancering: OLTP vs OLAP OLTP (On Line Transaction Processing) banken, luchtvaartmaatschappijen, reisburo s vele kleinschalige update-transacties fysieke organisatie hieraan aangepast beperkte ruimte voor zware queries (concurrency) update FlightEntries set status= booked, customerid= where flight=714 and date= and seat=119 5 Canonical application (DB) OLAP (On Line Analytical Processing) Typerende queries: Wat was onze omzet in hypotheken gedurende de afgelopen twee maanden? Hoe was dat vorig jaar in dezelfde periode? Snel switchen (dag, maand, kwartaal, jaar) Kunnen we trends ontdekken? 6 1

2 Canonical application (DB) OLAP data warehouse creatie off line, geen updates bewerkte selecties uit productiedatabases fysieke organisatie gericht op zware queries: data cube (indexstructuren, materialized views) historische data, belangrijke rol voor tijd data mining Data type(s) DB: classical types int, char, float, date beperkte ondersteuning van strings IR: text (granularity issues) In between: XML (semi structured) 7 8 DB: theory of sets/bags querytalen: gebaseerd op logica/algebra queries zijn i.h.a. exact resultaat is weer een tabel (view) grondslag voor systematische query processing en generieke optimalisatie klassiek, heeft diverse trends overleefd IR: text, beperkte of geen structuur queries zijn vaag: matching terms resultaat: elementaire datastructuur is de lijst kwaliteit matching: ranking maakt het verschil ranking is gebaseerd op probabilistische modellen data is vaag: enkelvoud, meervoud, homoniemen, synoniemen, spelfouten, spellingsvariaties, interpunctie, talen, alphabet (Grieks, Cyrillisch, Arabisch, Chinees, ) 9 10 IR: text indexering elementaire datastructuur is inverted list complicatie: approximate string matching ASM wordt in principe opgelost via dynamic programming ASM indexering via k-grams (of q-grams)

3 Wat is dit? GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL GGTTCTGCTGAAGTTAAAGGTCATGGT Matching protein strings GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL G+ +VK+HGKKV A+++++AH+D LS+LH KL GNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKL Gapped matching GSAQVKGHGKKVADALTNAVAHV---D--DMPNALSALSDLHAHKL H+ KV + +A ++ +L+ L+++H+ K NNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKNLGSVHVSKG Biological Sequence matching: query = een proteïne- of nucleotidestring antwoord = een collectie strings uit de DB die een hoge mate van similarity hebben met de query string Biological Sequence matching Basistechniek: dynamic programming aangepast aan biologisch-statistische modellen Heuristiek: lokale matching op basis van q-grams Practicum opgave 1 Implementeer een filtering-techniek op basis van q-grams die de kansrijke posities voor een match vindt (simulatie van BLAST2) Tool: een main-memory DBMS Bij opgave 1 wordt een simpele expander aangeleverd die vanuit een kansrijke positie een optimale ungapped match vindt Herschrijf deze om een optimale gapped match te vinden

4 Het resultaat van een IR-query is een lijst van documenten Sortering op relevantie: ranking Parameters/models voor ranking: term frequency (inverse) document frequency vector space model Ranking voor DB-queries? Geef mij appartementen in Barcelona voor tenminste 4 personen, nabij het centrum en dichtbij restaurants waar je voor 15 euro p.p. terecht kunt, liefst met uitzicht op zee met een huurprijs van maximaal 1000 euro per week maar liever goedkoper. Oh ja, en als het even kan met vaatwasser! Karakteristieken ranked database query conjunctie refererend aan veel attributen score per attribuut in plaats van true/false probleem 1: zero answers probleem 2: many answers Practicumopgave 2 Implementeer de concepten van ranked database querying Platform: Java-JDBC-DBnaarkeuze Topic 3: Google pagerank Vraag: Web gebruiker stelt een query via een aantal keywords. Stel ik heb N pagina s die matchen. Welke pagina s laat ik zien? Antwoord: De belangrijkste 10/20/100. Vraag: welke zijn dan de belangrijkste? Topic 3: Google pagerank Practicumopgave 3 Implementeer pagerank Platform: Java

5 Huishoudelijk Vragen? Topic 1: week Topic 2: week Topic 3: week Literatuur: online boek + artikelen + fragmenten uit Garcia-Molina Eindcijfer: P = (P1+P2+P3)/3 E = 0.6 * P * T P1, P2, P3 >= 4; P, T >=

DAR Approximate string matching Casus: biological sequence alignment

DAR Approximate string matching Casus: biological sequence alignment DAR Approximate string matching Casus: biological sequence alignment 1 Text search Approx string matching dynamic programming, edit distance example application: Google search Text indexing inverted list

Nadere informatie

Ranking database queries. Ranking in IR. Classic ranking in IR. Ranking in IR. Ranking in IR: score. Advanced Databases

Ranking database queries. Ranking in IR. Classic ranking in IR. Ranking in IR. Ranking in IR: score. Advanced Databases Advanced Databases Topic 3: ranking van database queries Ranking database queries Outline ranking in IR toepassing ranking bij database queries: many-answer problem zero-answer problem 1 2 Classic ranking

Nadere informatie

Smartsite ixperion Faceted Search

Smartsite ixperion Faceted Search dinsdag 26 oktober 2010 Smartsite ixperion Faceted Search Marc Derksen Uitgangspunten 2 woensdag 27 oktober 2010 Wat is Faceted Search? Nieuwe krachtige zoekomgeving voor Smartsite ixperion Zoekexpressies

Nadere informatie

DBMS. DataBase Management System. Op dit moment gebruiken bijna alle DBMS'en het relationele model. Deze worden RDBMS'en genoemd.

DBMS. DataBase Management System. Op dit moment gebruiken bijna alle DBMS'en het relationele model. Deze worden RDBMS'en genoemd. SQL Inleiding relationele databases DBMS DataBase Management System!hiërarchische databases.!netwerk databases.!relationele databases.!semantische databases.!object oriënted databases. Relationele databases

Nadere informatie

B.Sc. Informatica Module 4: Data & Informatie

B.Sc. Informatica Module 4: Data & Informatie B.Sc. Informatica Module 4: Data & Informatie Djoerd Hiemstra, Klaas Sikkel, Luís Ferreira Pires, Maurice van Keulen, en Jan Kamphuis 1 Inleiding Studenten hebben in modules 1 en 2 geleerd om moeilijke

Nadere informatie

ASRemote WebService. Via deze webservice kunt u:

ASRemote WebService. Via deze webservice kunt u: ASRemote WebService De ASRemote WebService is een SOAP Webservice die softwarematige communicatie met Exact Globe mogelijk maakt vanaf een willekeurige locatie op het internet. Via deze webservice kunt

Nadere informatie

Advanced Databases Topic 2: query processing aspects query optimisation. Query optimisation. Van SQL naar XRA. Algebraïsche herschrijving

Advanced Databases Topic 2: query processing aspects query optimisation. Query optimisation. Van SQL naar XRA. Algebraïsche herschrijving Advanced Databases Topic 2: query processing aspects query optimisation Query optimisation Outline: Basisregels algebraïsche herschrijving Schattingen Queryplan-generatie 1 2 Algebraïsche herschrijving

Nadere informatie

Business Intelligence. Toepassing BI Database en Datawarehouse BI proces BI Organisatie Implementatie BI

Business Intelligence. Toepassing BI Database en Datawarehouse BI proces BI Organisatie Implementatie BI Business Intelligence Toepassing BI Database en Datawarehouse BI proces BI Organisatie Implementatie BI Toepassing BI (Operationele) sturing Financieel (BBSC) Performance NIET voor ondersteuning proces

Nadere informatie

Thinking of development

Thinking of development Thinking of development Databases Arjan Scherpenisse HKU / Miraclethings Agenda voor vandaag Opdracht tussenstand State diagram / Observer pattern Bret Victor Databases 2/42 Opdracht tussenstand Slides

Nadere informatie



Nadere informatie

SEO. Website promotie

SEO. Website promotie SEO Website promotie SEO Website promotie Inhoud 1 Wat is SEO? 2 SEO Tips SEO Website promotie 1 Wat is SEO? 1 Wat is SEO? Afkorting SEO staat voor Search Engine Optimization, vertaald zoekmachineoptimalisatie.

Nadere informatie

Powerpoint presentatie College 5 Gilbert van Lierop & Farshad Salamat

Powerpoint presentatie College 5 Gilbert van Lierop & Farshad Salamat Powerpoint presentatie College 5 Gilbert van Lierop & Farshad Salamat Wat is een database? Een verzameling van georganiseerde data Een database bestaat uit applicaties, SQL en het DBMS Watis eendbms? EenDBMS

Nadere informatie

Les 2 Eenvoudige queries

Les 2 Eenvoudige queries Les 2 Eenvoudige queries XAMP Apache server ( http ) mysql server PHP myadmin IAM SQL oefeningen Database phpmyadmin Import : sql_producten.sql, sql_winkel.sql, sql_festival.sql SAMS SQL in 10 minuten

Nadere informatie

Magnutude 2012 Efficient BI. 18 september Joost de Ruyter van Steveninck

Magnutude 2012 Efficient BI. 18 september Joost de Ruyter van Steveninck Magnutude 2012 Efficient BI 18 september Joost de Ruyter van Steveninck 2 Inhoud Is BI nog niet efficiënt? Trends in BI Efficient BI: de trends in praktijk 3 Feedback van de gebruiker Informatie behoefte

Nadere informatie

SQL / Systeemanalyse

SQL / Systeemanalyse SQL / Systeemanalyse Wie ben ik Hans de Wit 44 jaar HBO BI in deeltijd gedaan Sinds 2008 werkzaam met BI / DWH med.hro.nl/wihan SQL De gegevens in een database vormen de grondstof voor informatie De informatie

Nadere informatie

Presentatie Rapportage Met SAP Business Objects

Presentatie Rapportage Met SAP Business Objects Presentatie Rapportage Met SAP Business Objects Verzorgd door: Camille van Dongen, itelligence Fouad Allabari, i3 Woerden 4 februari 2011 Agenda Voorstellen itelligence & i3 Business Intelligence SAP Business

Nadere informatie

Invantive Producer. Als integriteit en compliance noodzakelijk is. Maar niks extra mag kosten.

Invantive Producer. Als integriteit en compliance noodzakelijk is. Maar niks extra mag kosten. Invantive Producer Als integriteit en compliance noodzakelijk is. Maar niks extra mag kosten. Agenda Invantive Visie De Invantive Benadering Het Invantive Resultaat Invantive Producer Praktijkvoorbeelden

Nadere informatie

The End of an Architectural Era

The End of an Architectural Era The End of an Architectural Era M. Stonebraker, S. Madden, D. J. Abadi, S. Harizopoulos, N. Hachem, P. Helland Jorn Van Loock Inleiding Oorsprong relationele DBMS IBM System R (1974) DB2 Sybase SQL Server

Nadere informatie

Webapplicatie-generatie NIOC 2013

Webapplicatie-generatie NIOC 2013 Webapplicatie-generatie NIOC 2013 Eddy Luursema, Misja Nabben, Arnoud van Bers Research Group Model Based Information Systems Presentation Introduction M-BIS Data intensive systems Requirements Generation

Nadere informatie

Import N@Tschool! via NatSync. Presentatie René Merx School voor de Toekomst

Import N@Tschool! via NatSync. Presentatie René Merx School voor de Toekomst Import N@Tschool! via NatSync Presentatie René Merx School voor de Toekomst Samenvatting N@TSchool accounts, groepen en memberships IMS Global N@TConnect NatSync Configuratiebestand Verdere ontwikkelingen

Nadere informatie

Business Intelligence www.globalservices.be www.sap-training.be

Business Intelligence www.globalservices.be www.sap-training.be Business Intelligence www.globalservices.be www.sap-training.be Global Services + Business Intelligence = perfect match! Het concept Wenst u ook sneller inzicht in beleidsinformatie, rapportering en cijfers?

Nadere informatie

Relationele Databases 2002/2003

Relationele Databases 2002/2003 1 Relationele Databases 2002/2003 Hoorcollege 4 8 mei 2003 Jaap Kamps & Maarten de Rijke April Juli 2003 Plan voor Vandaag Praktische dingen 3.1, 3.2, 3.3, 3.4, 3.5. SQL Aantekeningen 2 Tabellen. Theorie

Nadere informatie

Relationele Databases 2002/2003

Relationele Databases 2002/2003 Relationele Databases 2002/2003 Hoorcollege 4 8 mei 2003 Jaap Kamps & Maarten de Rijke April Juli 2003 1 Plan voor Vandaag Praktische dingen Huiswerk 3.1, 3.2, 3.3, 3.4, 3.5. SQL Aantekeningen 2 Tabellen.

Nadere informatie

Starten van de tool De tool wordt opgestart door een web browser te openen (bij voorkeur Google Chrome) en in de adresbalk te typen:

Starten van de tool De tool wordt opgestart door een web browser te openen (bij voorkeur Google Chrome) en in de adresbalk te typen: Gist demo Toelichting op de interface en werking van de tool. v0.1, 20 januari 2016, Erik Boertjes v0.2, 1 februari 2016, Rianne Kaptein v0.3, 9 mei 2016, Rianne Kaptein Doel Met behulp van de tool beschreven

Nadere informatie

Multimedia Information Retrieval

Multimedia Information Retrieval Doel Multimedia Information Retrieval Opdracht 2: Text analysis versie 0.6, 25 november 2008 Onderzoeken van de kwantitatieve eigenschappen van een aantal teksten; het uitvoeren van een kwantitatieve tekstanalyse;

Nadere informatie

Invantive 2012 Release 1 (build 44)

Invantive 2012 Release 1 (build 44) Invantive 2012 Release 1 (build 44) Invantive Estate Invantive Vision Invantive Control Invantive Producer Invantive Query-programma Invantive Composition Invantive Studio 30 maart 2012 Oplossingen van

Nadere informatie

Het omzetten van een ER-diagram naar SQL

Het omzetten van een ER-diagram naar SQL Het omzetten van een ER-diagram naar SQL Huub de Beer Eindhoven, 4 juni 2011 Omzetting ER-diagram naar SQL in twee stappen 1: ER-Diagram relationeel model Onderwerp van hoofdstuk 3 Entiteittype relatie,

Nadere informatie

Vakgroep CW KAHO Sint-Lieven

Vakgroep CW KAHO Sint-Lieven Vakgroep CW KAHO Sint-Lieven Objecten Programmeren voor de Sport: Een inleiding tot JAVA objecten Wetenschapsweek 20 November 2012 Tony Wauters en Tim Vermeulen tony.wauters@kahosl.be en tim.vermeulen@kahosl.be

Nadere informatie

Databases - Inleiding

Databases - Inleiding Databases Databases - Inleiding Een database is een verzameling van een aantal gegevens over een bepaald onderwerp: een ledenbestand van een vereniging, een forum, login gegevens. In een database worden

Nadere informatie

DB architectuur. joost.vennekens@denayer.wenk.be

DB architectuur. joost.vennekens@denayer.wenk.be DB architectuur joost.vennekens@denayer.wenk.be DB - logisch perspectief - DB - fysisch perspectief - DBMS Fysische details van databank beheren Zodat gebruiker zich enkel om logische perspectief moet

Nadere informatie


INSPIRATION & IDEAS. RESULTS! Not just websites Onderwerpen Lang leve de credietcrisis Marketing wordt ANDERS Introductie Online Marketing Verkoop Service Zoekmachine Marketing (SEM) Hoe werkt Google The Magic Word Zoekwoorden Zoekmachine Optimalisatie

Nadere informatie

Profiel Manfred Dousma

Profiel Manfred Dousma Profiel Manfred Dousma Personalia Naam ing. M.P. (Manfred) Dousma Adres Kramerstraat 42 9731 MK Groningen Geslacht man Geboortedatum 11 september 1978 Geboorteplaats Appingedam Nationaliteit Nederlandse

Nadere informatie

PL/SQL. Declaraties van variabelen. Structuur PL/SQL is een blok-georiënteerde taal: Toekenningen

PL/SQL. Declaraties van variabelen. Structuur PL/SQL is een blok-georiënteerde taal: Toekenningen PL/SQL PL/SQL is een procedurele uitbreiding op SQL, omdat SQL op zich niet krachtig genoeg is om complexe databank applicaties te ontwikkelen. Server-side functies, of stored procedures worden op de database

Nadere informatie

SQL datadefinitietaal

SQL datadefinitietaal SQL datadefinitietaal We kunnen er het schema van de database mee bepalen: metadata toevoegen, wijzigen en verwijderen uit een database. Basiscommando's: CREATE : toevoegen van metagegevens DROP : verwijderen

Nadere informatie

1ste bach TEW. Informatiesystemen. samenvatting + minicases. uickprinter Koningstraat 13 2000 Antwerpen www.quickprinter.be 3.

1ste bach TEW. Informatiesystemen. samenvatting + minicases. uickprinter Koningstraat 13 2000 Antwerpen www.quickprinter.be 3. 1ste bach TEW Informatiesystemen samenvatting + minicases Q uickprinter Koningstraat 13 2000 Antwerpen www.quickprinter.be 119 3.50 EUR Nieuw!!! Online samenvattingen kopen via www.quickprintershop.be

Nadere informatie

PROGRAMMA 2011-2012. Vak: Informatica..

PROGRAMMA 2011-2012. Vak: Informatica.. Vak: Informatica.. Laag: vwo-. PROGRAMMA 2011-2012 week leerstof dagen toets overig 34-26.08 zomervakantie Bespreking PTA-404 1. Deze week: uitreiking van de Praktische Opdracht Programmeren Herhaling

Nadere informatie


ORION XERVER WEB-BASED DIGITALE DOCUMENTVERWERKING ORION XERVER VOORDELEN ORION XERVER WEB-BASED DIGITALE DOCUMENTVERWERKING In de moderne kantooromgevingen doet Het Nieuwe Werken zijn intrede. Mensen werken op flexibele plekken en flexibele tijden met flexibele systemen. Echter,

Nadere informatie

Onder de motorkap van Microsoft Azure Web Sites. Eelco Koster Software architect ORDINA

Onder de motorkap van Microsoft Azure Web Sites. Eelco Koster Software architect ORDINA Onder de motorkap van Microsoft Azure Web Sites Eelco Koster Software architect ORDINA Agenda Introductie Architectuur Project Kudu Azure Resource Manager Doel Dieper inzicht geven in de werking van Azure

Nadere informatie



Nadere informatie

Examen georganiseerd met het oog op de aanwerving en de samenstelling van wervingsreserves van. ASSISTENTEN (systeembeheerder en ontwikkelaar)

Examen georganiseerd met het oog op de aanwerving en de samenstelling van wervingsreserves van. ASSISTENTEN (systeembeheerder en ontwikkelaar) Examen georganiseerd met het oog op de aanwerving en de samenstelling van wervingsreserves van ASSISTENTEN (systeembeheerder en ontwikkelaar) met een in het Frans gesteld diploma voor de dienst Informatica

Nadere informatie

Plan van Aanpak. Plan van Aanpak. November 2003. Student Naam: David Fremeijer Studentnr: 0249432 E-mail: david@fremeijer.net

Plan van Aanpak. Plan van Aanpak. November 2003. Student Naam: David Fremeijer Studentnr: 0249432 E-mail: david@fremeijer.net Plan van Aanpak Plan van Aanpak November 2003 Student Naam: David Fremeijer Studentnr: 0249432 E-mail: david@fremeijer.net Universiteit Nijmegen Begeleider: Theo van der Weide Referent: Gert Veldhuijzen

Nadere informatie

LIMO zoekt gedrukte EN elektronische publicaties - in de catalogi van de K.U.Leuven bibliotheken en de andere bibliotheken van Libisnet -in LIRIAS =

LIMO zoekt gedrukte EN elektronische publicaties - in de catalogi van de K.U.Leuven bibliotheken en de andere bibliotheken van Libisnet -in LIRIAS = LIMO zoekt gedrukte EN elektronische publicaties - in de catalogi van de K.U.Leuven bibliotheken en de andere bibliotheken van Libisnet -in LIRIAS = academische publicaties K.U.Leuven - databanken en e-book

Nadere informatie


INBOUND MARKETING LIVE WEBSITE SEO - ZOEKMACHINE OPTIMALISATIE DE GOOGLE MAGIC SHOW Webinar LIVE WEBSITE SEO - ZOEKMACHINE OPTIMALISATIE DE GOOGLE MAGIC SHOW Bram van Ast TeamForce Online Marketing Solutions Bazoon Marketing Services Onderwerpen Welkom en Introductie Kennismaking met

Nadere informatie

Relationele Databases 2002/2003

Relationele Databases 2002/2003 1 Relationele Databases 2002/2003 Hoorcollege 3 24 april 2003 Jaap Kamps & Maarten de Rijke April Juli 2003 Plan voor Vandaag Praktische dingen 2.1, 2.3, 2.6 (alleen voor 2.2 en 2.3), 2.9, 2.10, 2.11,

Nadere informatie

Lekker snel XML met SQL (.nl)

Lekker snel XML met SQL (.nl) Lekker snel met SQL (.nl In steeds meer opdrachten kom je als requirement tegen. Omdat het lekker makkelijk is of omdat de interface die je moet aanspreken het vereist. Dit is zeker het geval wanneer je

Nadere informatie

Vervolg op het STEVIN Programma

Vervolg op het STEVIN Programma Vervolg op het STEVIN Programma Onderzoek en Ontwikkeling Internationaal Europa Focus op Multilingual en Cross-lingual Information Processing Meer development dan Research Kan verschuiven in de komende

Nadere informatie

Internet Marketing Termen

Internet Marketing Termen Internet Marketing Termen Als beginnend Internet Marketeer ga je veel termen tegen komen, die je in verwarring zullen brengen. Hieronder heb ik een lijst met termen voor je samengesteld om jouw leven als

Nadere informatie

Koppeling met een database

Koppeling met een database PHP en MySQL Koppeling met een database 11.1 Inleiding In PHP is het eenvoudig om een koppeling te maken met een database. Een database kan diverse gegevens bewaren die met PHP aangeroepen en/of bewerkt

Nadere informatie

INHOUDSOPGAVE 3. 3.5 Het Boekenwinkeltje... 90 3.5.1 Registreer.aspx... 90 3.6 Opgaven... 97

INHOUDSOPGAVE 3. 3.5 Het Boekenwinkeltje... 90 3.5.1 Registreer.aspx... 90 3.6 Opgaven... 97 Inhoudsopgave 1 Inleiding 8 1.1 Het.Net Framework................................ 8 1.1.1 Het.Net Ontwikkelingsmodel....................... 8 1.1.2 Compilatie en Uitvoering in.net.....................

Nadere informatie

Knowledge Engineering @Work

Knowledge Engineering @Work Knowledge Engineering @Work REGITEL-bijeenkomst Aachen, 22/10/2013 1 Een inleidend filmpje over Knowledge Engineering is hier te bekijken (3 min.) 2 Ons Voorstel β-talent binden aan uw bedrijf Inzet op

Nadere informatie

TranSearch WEBPlus. Overzicht

TranSearch WEBPlus. Overzicht TranSearch WEBPlus Overzicht TranSearch WebPlus is de laatste in een lange rij intuïtieve oplossingen van UK Software Limited. TranSearch WebPlus is wederom een hoogstaande oplossing voor datamanagement

Nadere informatie

Johannes Koning. Koning Automatiseringsdiensten & Advies. A Nieuwe Schoolweg 2 A 9756 BB Glimmen T +31628256540 E info@koningautomatisering.

Johannes Koning. Koning Automatiseringsdiensten & Advies. A Nieuwe Schoolweg 2 A 9756 BB Glimmen T +31628256540 E info@koningautomatisering. Johannes Koning A Nieuwe Schoolweg 2 A 9756 BB Glimmen T +31628256540 E info@koningautomatisering.nl I www.koningautomatisering.nl Cursussen Jaar Teradata ( SQL, Database architecture ) 2014 Next Generation

Nadere informatie

Self Service BI. de business

Self Service BI. de business BI in de praktijk Self Service BI Breng de kracht van BI naar de business Luc Alix Sogeti Nederland B.V. Redenen voor Business Intelligence Sneller kunnen beslissen 42 % Beter kunnen beslissen 42 % Concurrentieel

Nadere informatie

ODS: Open Directory service. Wat is ODS?

ODS: Open Directory service. Wat is ODS? Wat is ODS? Wat is ODS? Geïntegreerde Meta-directorie voor OpenScape Office LX/MX/HX voor het zoeken van contacten in verschillende databasen en directories. Toegang verlenen naar verschillende directories.

Nadere informatie


MODULEBESCHRIJVING Databases DBS1 MODULEBESCHRIJVING Databases DBS1 Samensteller(s): Richard van den Ham Datum: 30-08-2012 Versie: 1.0 Module: Databases Identificatie Progresscode: DBS1 Semester: 1 Omvang: 140 SBUs/ 5 ECTS-punten Lestijd:

Nadere informatie

De MySQL C API. Variabelen in C Functies in C Pointers in C

De MySQL C API. Variabelen in C Functies in C Pointers in C LinuxFocus article number 304 http://linuxfocus.org De MySQL C API door Özcan Güngör Over de auteur: Ik gebruik Linux sinds 1997. Vrijheid, flexibiliteit en opensource. Dat

Nadere informatie

Inleiding Informatiekunde I

Inleiding Informatiekunde I Wat gaan we doen, vandaag? College 5, 28 november 2006 Wat gaan we doen, vandaag? Overzicht van de colleges 31 oktober Inleiding cursus 7 november Rondleiding Letterenbibliotheek 14 november Databases

Nadere informatie

SQL & Datamodelleren

SQL & Datamodelleren SQL & Datamodelleren HVA-CMD-V1-datamodelleren Algemene handleiding bij het lesprogramma 2012-2013 Inhoud Inhoud... 2 Inleiding... 3 Leerdoelen:... 3 Plaats in het leerplan:... 3 Werkwijze:... 3 Lesstof:...

Nadere informatie

Educagen. Wij zijn specialisten in Education en in Gen met een ervaring in consultancy en training van meer dan 20 jaar in de Gen-omgeving.

Educagen. Wij zijn specialisten in Education en in Gen met een ervaring in consultancy en training van meer dan 20 jaar in de Gen-omgeving. Educagen Wij zijn specialisten in Education en in Gen met een ervaring in consultancy en training van meer dan 20 jaar in de Gen-omgeving. Educagen leidt organisaties en hun medewerkers op om systemen

Nadere informatie

Module 1 Search & Analytics

Module 1 Search & Analytics Module 1 Search & Analytics Programma vandaag Inleiding Search Wat is SEM? Opzet van een SEA campagne Recap Inleiding Search Wat is Search? Zoekmachines zijn de databases van onze intenties - John Battelle

Nadere informatie

SKILLS (Ervaring in jaren)

SKILLS (Ervaring in jaren) Contact the Agency Laurens Simonse 02201031 L.simonse@lsg.nl Bart Nijskens 052302211 B.nijskens@lsg.nl ROCKSTARS Rob Roepnaam: Rob Regio: Eindhoven Geboortedatum: 23 maart 19 Nationaliteit: Nederlands

Nadere informatie

SDU Kennissessie. Edwin Hof Manager Account Management. Theo Pols Account Manager

SDU Kennissessie. Edwin Hof Manager Account Management. Theo Pols Account Manager Edwin Hof Manager Account Management Theo Pols Account Manager Vertrouwelijke informatie Deze presentatie is eigendom van Traffic4u BV en is strikt vertrouwelijk. Het bevat informatie slechts bestemd voor

Nadere informatie

05. App Store Optimalisatie

05. App Store Optimalisatie WHITEPAPER IN 5 MINUTEN O K T O B E R 2 0 1 2 05. App Store Optimalisatie Introductie Het aantal apps in de diverse app stores is enorm. Apple heeft nu 700.000 apps, in de Google Play Store zijn het er

Nadere informatie

.NET of.not in de praktijk voorbij het onderbuikgevoel

.NET of.not in de praktijk voorbij het onderbuikgevoel .NET of.not in de praktijk voorbij het onderbuikgevoel Robert Jan Elias & Maarten Gribnau robertjan.elias@mavim.com & maarten.gribnau@mavim.com http://www.mavim.com 1/15 Inhoud Mavim het bedrijf Mavim

Nadere informatie

Ondersteunde platformen voor Crystal Reports XI ====================================== (c) 2004 Business Objects

Ondersteunde platformen voor Crystal Reports XI ====================================== (c) 2004 Business Objects Ondersteunde platformen voor Crystal Reports XI ====================================== (c) 2004 Business Objects De volgende platforms worden ondersteund op het moment dat versie XI wordt uitgebracht.

Nadere informatie

Zoekmachinegericht schrijven Advanced Bas van den Beld Rijksinspec8es 21/04/2011

Zoekmachinegericht schrijven Advanced Bas van den Beld Rijksinspec8es 21/04/2011 Zoekmachinegericht schrijven Advanced Bas van den Beld Rijksinspec8es 21/04/2011 Programma Wie ben ik? Opbouw van een site Zoekwoorden Links en linksculp8ng AFeeldingen Universal search Huishoudelijk Vragen

Nadere informatie

Inhoud. Voorwoord Belangrijkste kenmerken van dit boek De opzet van dit boek Over de auteur Woord van dank

Inhoud. Voorwoord Belangrijkste kenmerken van dit boek De opzet van dit boek Over de auteur Woord van dank v Voorwoord Belangrijkste kenmerken van dit boek De opzet van dit boek Over de auteur Woord van dank 1 Introductie: data en informatie 1.0 Wat leer je in dit hoofdstuk? 1.1 Verschil tussen gegevens en

Nadere informatie


VAN PAPIERSTROOM NAAR INFORMATIESTROOM VAN PAPIERSTROOM NAAR INFORMATIESTROOM MET ZELF LERENDE DOCUMENTHERKENNING Een continue stroom aan binnenkomende post en interne documenten. Wie herkent het niet? Het vergt tijd en energie om al deze documenten

Nadere informatie

Bedrijf Omschrijving Periode

Bedrijf Omschrijving Periode Curriculum senior adviseur project manager Algemeen XXX is een senior GIS consultant met grote ervaring in projectleiding, ontwerp, bouw en het vertalen van klantvragen naar GIS oplossingen. Hij spreekt

Nadere informatie

Taxis Pitane SQL beheerder. Censys BV - Eindhoven

Taxis Pitane SQL beheerder. Censys BV - Eindhoven Taxis Pitane SQL beheerder Censys BV - Eindhoven Inhoud Wat is Taxis Pitane SQL beheerder?... 3 Kenmerken van de software... 3 De juiste SQL server editie voor uw organisatie... 3 SQL Server 2008 Express...

Nadere informatie



Nadere informatie

Systeemarchitecturen en opslag van gegevens

Systeemarchitecturen en opslag van gegevens Systeemarchitecturen en opslag van gegevens Deel 3: zoeken in ongestructureerde gegevens Dr. Wilfried Lemahieu wilfried.lemahieu@econ.kuleuven.ac.be Gestructureerde versus ongestructureerde gegevens De

Nadere informatie

SQL. Datamodellering 2008

SQL. Datamodellering 2008 SQL Datamodellering 2008 1 Wat is SQL? SQL is een standaard interactieve bevragings- en definitietaal voor relationele DBMSen SQL is een set-based, declaratieve query-taal (dus niet procedureel!) DB-leveranciers

Nadere informatie

SQL. Wat is SQL? Geschiedenis SQL SQL DMO 2008 1. Datamodellering 2008

SQL. Wat is SQL? Geschiedenis SQL SQL DMO 2008 1. Datamodellering 2008 SQL Datamodellering 2008 1 Wat is SQL? is een standaard interactieve bevragings- en definitietaal voor relationele DBMSen is een set-based, declaratieve query-taal (dus niet procedureel!) DB-leveranciers

Nadere informatie

Zelftest Informatica-terminologie

Zelftest Informatica-terminologie Zelftest Informatica-terminologie Document: n0947test.fm 01/07/2015 ABIS Training & Consulting P.O. Box 220 B-3000 Leuven Belgium TRAINING & CONSULTING INTRODUCTIE Deze test is een zelf-test, waarmee u

Nadere informatie

Inleiding tot Func.oneel Programmeren les 3

Inleiding tot Func.oneel Programmeren les 3 Inleiding tot Func.oneel Programmeren les 3 Kris Luyten, Jo Vermeulen {kris.luyten,jo.vermeulen}@uhasselt.be Exper.secentrum voor Digitale Media Universiteit Hasselt Currying Currying: een func.e met meerdere

Nadere informatie

Capita Selecta Design Patterns voor administratieve applicaties

Capita Selecta Design Patterns voor administratieve applicaties Capita Selecta voor administratieve applicaties Bij afstudeerproject: Generiek framework voor administratieve toepassingen in een webgeörienteerde omgeving Henk van de Ridder 26 augustus 2006 Inhoud 26

Nadere informatie

Research Bio-markers Concept Conference NIOC 2013 1. Probleem

Research Bio-markers Concept Conference NIOC 2013 1. Probleem Onderzoek naar de mogelijke ontwikkeling van een intelligent web-based systeem gericht op screening & monitoring op colorectale kanker van patiënt risico groepen met behulp van op bloedonderzoek gebaseerde

Nadere informatie

Documentatie van BusinessObjects XI-producten

Documentatie van BusinessObjects XI-producten Documentatie van XI-producten De meest recente versie van dit documentatieoverzicht en alle PDF-handleidingen zijn beschikbaar via http://support.businessobjects.com/ documentation. ommige van deze handleidingen

Nadere informatie

Voorwoord... v. Over de schrijver... vii. 0 Inleiding... 1. 0.1 De Google zoekmachine... 1

Voorwoord... v. Over de schrijver... vii. 0 Inleiding... 1. 0.1 De Google zoekmachine... 1 Inhoud Voorwoord... v Over de schrijver... vii 0 Inleiding... 1 0.1 De Google zoekmachine... 1 Statistieken... 1 De Google filosofie... 2 Is Google objectief?... 4 De zoekresultaten... 7 Personalisering

Nadere informatie

1 Client/Server. 2 Geschiedenis. 3 Toekomst

1 Client/Server. 2 Geschiedenis. 3 Toekomst Deel 1 Inleiding 1 Client/Server 2 Geschiedenis 3 Toekomst Het client-server model is een model voor de samenwerking tussen twee of meer programma's, die zich op verschillende computers kunnen bevinden.

Nadere informatie

Choral + Spraaktechnologie: ingezet voor de ontsluiting van audiovisuele

Choral + Spraaktechnologie: ingezet voor de ontsluiting van audiovisuele Choral + Spraaktechnologie: ingezet voor de ontsluiting van audiovisuele archieven De benadering Doel van het NWO CATCH project CHoral (2006-2011): onderzoek en ontwikkel geautomatiseerde annotatieen zoek

Nadere informatie

Curriculum Vitae Ishak Atak. www.ishakatak.nl. Naam : Ishak Atak Roepnaam : Ishak. Woonplaats : Utrecht Geboorte datum : 13-05-1983

Curriculum Vitae Ishak Atak. www.ishakatak.nl. Naam : Ishak Atak Roepnaam : Ishak. Woonplaats : Utrecht Geboorte datum : 13-05-1983 Naam : Ishak Atak Roepnaam : Ishak Woonplaats : Utrecht Geboorte datum : 13-05-1983 Tel. : +316-46 17 76 00 Beschikbaar : Full time December 2015 Email: : contact@ishakatak.nl Datum CV : November 2015

Nadere informatie

Taal- en Informatietechnologie. Taal- en Informatietechnologie. Informatie en tekst. Over de cursus. Over de cursus: opbouw. Over de cursus (2)

Taal- en Informatietechnologie. Taal- en Informatietechnologie. Informatie en tekst. Over de cursus. Over de cursus: opbouw. Over de cursus (2) Taal- en Informatietechnologie Emiel Krahmer & Antal van den Bosch {E.J.Krahmer,antalb}@uvt.nl eerste semester 2003-2004 Taal- en Informatietechnologie Informatietechnologie: informatie halen uit tekst

Nadere informatie

Nederlands. (taal waarin de brochure is gemaakt) invantive control. grip op Excel. Voor: 1.1

Nederlands. (taal waarin de brochure is gemaakt) invantive control. grip op Excel. Voor: 1.1 Nederlands (taal waarin de brochure is gemaakt) invantive control grip op Excel Voor: Inhoudsopgave 2 Samenwerken vanuit één database De Excel tijdbom. Zeg dag tegen doorgekopieerde fouten. Voorbeeldtoepassingen.

Nadere informatie

Online marketing. De weg naar online succes. Presentatie door: Eelke Kuipers

Online marketing. De weg naar online succes. Presentatie door: Eelke Kuipers Online marketing De weg naar online succes Presentatie door: Eelke Kuipers Inhoud Wat is online marketing? Internet strategie Marketing middelen - Zoekmachine marketing - Social media - E-mailmarketing

Nadere informatie

Misvattingen (korte) Intro Hadoop Hadoop & BI Demo logparsing met Hadoop Showcase Datameer Stappenplan Vragen

Misvattingen (korte) Intro Hadoop Hadoop & BI Demo logparsing met Hadoop Showcase Datameer Stappenplan Vragen Baarn, 5 juli 2012 Agenda Misvattingen (korte) Intro Hadoop Hadoop & BI Demo logparsing met Hadoop Showcase Datameer Stappenplan Vragen 18-07-2012 2 Misvattingen Meest gehoorde bezwaren Hadoop is alleen

Nadere informatie

Big Data en Variabele Data Printing

Big Data en Variabele Data Printing Big Data en Variabele Data Printing Roelof Janssen Definitie Big Data Verwerken en interpreteren van grote en/of gevarieerde dataverzamelingen Doug Laney, Gartner: groeiend volume van data Socialmedia

Nadere informatie

PROGRAMMA 2011-2012. Vak: informatica..

PROGRAMMA 2011-2012. Vak: informatica.. Vak: informatica.. Laag: Havo-. PROGRAMMA 2011-2012 week leerstof dagen toets overig 34-26.08 zomervakantie Bespreking PTA-404 Deze week: uitreiking van de Praktische Opdracht Programmeren Herhaling theorie

Nadere informatie

Programmeren. Cursus Python

Programmeren. Cursus Python Programmeren Cursus Python Cursus Python Omschrijving In deze cursus leren de deelnemers te programmeren in de objectgeoriënteerde programmeertaal Python. Python is een taal die vaak wordt gebruikt voor

Nadere informatie

In deze Tips van de Helpdesk kijken we naar een nieuwe functie in STN on the Web: De Patent Family Manager!

In deze Tips van de Helpdesk kijken we naar een nieuwe functie in STN on the Web: De Patent Family Manager! Tips van de Helpdesk Juli 2011 Cobidoc helpdesk: - 0206880333 - Helpdesk@cobidoc.nl DE PATENT FAMILY MANAGER OP STN ON THE WEB In deze Tips van de Helpdesk kijken we naar een nieuwe functie in STN on the

Nadere informatie

Inhoud van deze handleiding

Inhoud van deze handleiding Inhoud van deze handleiding Wat is Limo Werken in Limo Om optimaal te werken: meld je aan in LIMO, Thuiswerken = gebruik de EZProxy Zoeken in Limo Zoeken: algemeen Zoektips Zoeken: simple and advanced

Nadere informatie

Les 10 : Aanmaken van een database (deel2).

Les 10 : Aanmaken van een database (deel2). Les 10 : Aanmaken van een database (deel2). Wat is een database? Een centrale opslagruimte voor gegevens. Alle informatie wordt centraal opgeslagen en kan door iedereen geraadpleegd worden. Voordelen van

Nadere informatie

Automatisch Testen. Customer Business Lunch. 6 november 2014. Netherlands Germany Switzerland Serbia

Automatisch Testen. Customer Business Lunch. 6 november 2014. Netherlands Germany Switzerland Serbia Automatisch Testen Netherlands Germany Switzerland Serbia Customer Business Lunch 6 november 2014 3 Vraag? Doen wij al aan automatisch testen? 4 Agenda Automatisch testen Waarom? Mogelijkheden Demo Conclusie

Nadere informatie

Whitepaper Search & Display Advertising Haal maximale resultaten door structuur, optimalisatie en analyse.

Whitepaper Search & Display Advertising Haal maximale resultaten door structuur, optimalisatie en analyse. Whitepaper Search & Display Advertising Haal maximale resultaten door structuur, optimalisatie en analyse. Auteur: Onetomarket Inhoudsopgave 1. Inleiding... 3 2. Wat is Search Engine Advertising?... 4

Nadere informatie

PLANNING. Korte voorstelling OMCollective. Welke tools voor welk bedrijf en welke sector? Google kijkt bij je binnen!

PLANNING. Korte voorstelling OMCollective. Welke tools voor welk bedrijf en welke sector? Google kijkt bij je binnen! PLANNING. Inleiding Korte voorstelling OMCollective Online marketing Vormen, kanalen & tools Wie, wat, wanneer? Welke tools voor welk bedrijf en welke sector? Uitsmijter Google kijkt bij je binnen! Vragen

Nadere informatie

Sparse columns in SQL server 2008

Sparse columns in SQL server 2008 Sparse columns in SQL server 2008 Object persistentie eenvoudig gemaakt Bert Dingemans, e-mail : info@dla-os.nl www : http:// 1 Content SPARSE COLUMNS IN SQL SERVER 2008... 1 OBJECT PERSISTENTIE EENVOUDIG

Nadere informatie

Google is wereldwijd de meest gebruikte zoekmachine, andere populaire zoekmachines zijn Yahoo, Bing en Baidu (Chinees).

Google is wereldwijd de meest gebruikte zoekmachine, andere populaire zoekmachines zijn Yahoo, Bing en Baidu (Chinees). SEO Techniek Search Engines/ Zoekmachines Google is wereldwijd de meest gebruikte zoekmachine, andere populaire zoekmachines zijn Yahoo, Bing en Baidu (Chinees). Zoekmachines indexeren webpagina's geautomatiseerd

Nadere informatie