4 VWO thema 4 Genetica EXAMENTRAINER OEFENVRAGEN

Save this PDF as:
 WORD  PNG  TXT  JPG

Maat: px
Weergave met pagina beginnen:

Download "4 VWO thema 4 Genetica EXAMENTRAINER OEFENVRAGEN"

Transcriptie

1 Examentrainer Vragen Erfelijke kaalheid De aanwezigheid of het geheel of gedeeltelijk ontbreken van hoofdhaar (kaalheid) berust op de allelen H n k (niet kaal) en H (kaal). In aanwezigheid van hoge concentraties van het hormoon testosteron is het allel H k dominant over het allel H n, bij lage concentraties testosteron is het allel H n dominant over het allel H k. Een man met genotype H k H n en een vrouw met het genotype H k H n krijgen samen een aantal kinderen. 1 Welk percentage van hun zonen heeft op grond van deze gegevens kans om op latere leeftijd kaal te worden? A 0% B 25% C 33% D 50% E 75% Sommige vrouwen hebben tot ongeveer hun zestigste jaar veel haar en worden daarna geleidelijk kaal. Dit wordt mede veroorzaakt doordat hun testosteronspiegel stijgt. 2 Welk genotype ligt, of welke genotypen liggen aan de kaalheid van die vrouwen ten grondslag? A alleen H k H k B alleen H k H n C alleen H n H n D alleen H k H k en H k H n E alleen H k H n en H n H n F H k H k en H k H n en H n H n Bron: examen vwo Uitgeverij Malmberg

2 Kleurenblindheid Bij mensen is het gen voor een bepaalde vorm van kleurenblindheid X-chromosomaal. Eén op de zeven niet-kleurenblinde vrouwen is hiervoor heterozygoot. Een man en een vrouw kunnen normaal kleuren zien. Deze twee mensen krijgen een kind. Over hun voorouders zijn geen gegevens bekend. Aangenomen mag worden dat er geen mutatie of crossing-over heeft plaatsgevonden. 3 Hoe groot is de kans dat dit kind die bepaalde vorm van kleurenblindheid heeft? A 0 B 1/196 C 1/49 D 1/28 E 1/14 F 1/4 In afbeelding 1 is de stamboom van een familie gegeven waarin de ziekte agammaglobulinemie voorkomt. Lijders aan deze erfelijke ziekte zijn verhoogd vatbaar voor infecties. Afbeelding 1 Aangenomen mag worden dat er geen mutatie of crossing-over heeft plaatsgevonden. 4 Is het gen dat deze ziekte veroorzaakt dominant of recessief, of is dat uit deze stamboom niet af te leiden? En is het gen X-chromosomaal of niet X-chromosomaal, of is dat uit deze stamboom niet af te leiden? Bron: examen vwo Man of vrouw? Soms is het onduidelijk of iemand een man of een vrouw is. Meestal is er dan ook sprake van onvruchtbaarheid. Soms groeit een genotypische jongen (genotype XY) fenotypisch uit tot een meisje dat onvruchtbaar is. Oorzaak kan zijn de uiterst zeldzame, recessief autosomaal overervende afwijking ADS (5-Alfareductase Deficiëntie Syndroom). Door het ontbreken van een enzym wordt het geproduceerde testosteron niet omgezet in dihydrotestosteron, dat de vermannelijking van de uitwendige geslachtsorganen stimuleert. Bij een andere afwijking, het AOS (Androgeen Ongevoeligheid Syndroom), is er sprake van een afwijking van een gen in het X-chromosoom. Kinderen met dit syndroom hebben het genotype XY, maar het receptoreiwit dat door het afwijkende recessieve gen gecodeerd wordt is niet gevoelig voor testosteron en ook niet voor dihydrotestosteron. Daardoor ontwikkelen ook deze kinderen zich fenotypisch tot een (onvruchtbaar) meisje. 2 Uitgeverij Malmberg

3 In een roman van Eugenides komt een XY-meisje, Calliope, voor met de afwijking ADS. In afbeelding 2 is de stamboom van haar familie weergegeven. Twee van haar grootouders (nummer 4 en nummer 5) zijn broer en zus. Afbeelding 2 1p 5 Leg uit aan de hand van de stamboom dat Calliope ADS geërfd kan hebben van haar overgrootvader (nummer 2 in de stamboom). 6 Leg uit dat Calliope géén AOS geërfd kan hebben van haar overgrootvader (nummer 2 in de stamboom). Bron: examen vwo Spierdystrofie De zogenoemde spierdystrofie van Duchenne is een ernstige erfelijke aandoening, berustend op één gen, die meestal alleen bij jongens voorkomt. Afbeelding 3 geeft een stamboom van een familie waarin deze vorm van spierdystrofie voorkomt. Aangenomen wordt dat geen mutatie en geen crossing-over plaatsvinden. Afbeelding 3 1p 7 Is het gen dat deze vorm van spierdystrofie veroorzaakt, dominant of recessief of is dat uit deze stamboom niet te bepalen? Leg je antwoord uit met behulp van de stamboom in afbeelding 3. 8 Waardoor komt spierdystrofie van Duchenne meestal alleen bij jongens voor? Bron: examen vwo Uitgeverij Malmberg

4 Erfelijke informatie In 1968 ontvingen de onderzoekers Marshall Nirenberg en Gobind Khorana de Nobelprijs voor hun werk over mrna en de eiwitsynthese. In hun experimenten gebruikten zij onder andere mrna dat langs kunstmatige weg was gevormd en dat uitsluitend was samengesteld uit afwisselend uracil- en cytosine-nucleotiden (poly[uc] n). Dit mrna werd toegevoegd aan een celextract waarin translatie mogelijk was. Het polypeptide dat in dit mengsel werd geproduceerd, bestond uit slechts twee verschillende aminozuren die elkaar telkens afwisselden. 9 Welke aminozuren zijn dit geweest? A arginine en glutaminezuur B arginine en leucine C glutaminezuur en lysine D leucine en serine E lysine en serine Oorspronkelijk wisten de onderzoekers niet of de aminozuurcodons uit een even of een oneven aantal nucleotiden zouden bestaan. 10 Uit hoeveel verschillende aminozuren zou een polypeptide zijn opgebouwd als de codons van het gebruikte mrna (poly[uc] n) uit vier nucleotiden zouden bestaan? A 1 B 2 C 4 D 16 E 64 F 256 Het deel van een mrna-molecuul dat codeert voor de eerste zes aminozuren van een bepaald polypeptide is: UAU AAG UGU UAA UCG GUA. 11 Noem de 5 -kant en geef aan op grond waarvan je bepaalt wat de 5 -kant is. Bron: vwo examen Oorsmeer Japanse onderzoekers hebben aangetoond dat een substitutie van één nucleotide in het genoom van de mens een merkbare verandering in de viscositeit van het oorsmeer tot gevolg heeft. Oorsmeer wordt gevormd door klieren in de uitwendige gehoorgang. Het komt bij mensen in twee vormen voor: de natte en de droge vorm. Nat oorsmeer is bruin en plakkerig, droog oorsmeer is meer grijs van kleur en vlokkig. Het allel voor nat oorsmeer (N) is dominant over het allel voor droog oorsmeer (n). Het verschil tussen deze twee allelen is de substitutie van één nucleotide, op plaats 538 van het ABCC11-gen van chromosoom 16. Een nucleotide met de base guanine (in allel N) is daar vervangen door een nucleotide met adenine (in allel n). Deze substitutie is een 'niet-synonieme' puntmutatie. Dat houdt in dat als gevolg van deze substitutie het codon waarin deze puntmutatie heeft plaatsgevonden, voor een ander aminozuur codeert dan het oorspronkelijke. 4 Uitgeverij Malmberg

5 Substitutie van het derde nucleotide in het codon 5 AGT 3 in de coderende streng (dus niet de matrijsstreng of template streng) van een willekeurig DNA-molecuul kan een synonieme of een niet-synonieme mutatie veroorzaken. 12 In welk geval betreft het hier een synonieme mutatie? Als het laatste nucleotide van dit codon verandert in een nucleotide met de base A adenine B cytosine C guanine Het eiwit dat door het allel voor nat oorsmeer gecodeerd wordt, speelt een rol bij het transport van stoffen door membranen. Ten gevolge van slechts één ander aminozuur werkt dit genproduct niet meer. 13 Leg uit hoe de verandering van slechts één aminozuur kan leiden tot een onwerkzaamheid van dit genproduct. Leg uit hoe een ander type oorsmeer daarvan het gevolg kan zijn. In afbeelding 4 is de nucleotidenvolgorde (alleen van de exons) in het DNA van het allel voor nat oorsmeer weergegeven. Onder de nucleotidenvolgorde is de aminozuurvolgorde weergegeven van het eiwit waarvoor dit allel codeert. Afbeelding 4 1 atgactagga agaggacata ctgggtgccc aactcttctg gtggcctcgt gaatcgtggc 61 atcgacatag gcgatgacat ggtttcagga cttatttata aaacctatac tctccaagat 121 ggcccctgga gtcagcaaga gagaaatcct gaggctccag ggagggcagc tgtcccaccg 181 tgggggaagt atgatgctgc cttgagaacc atgattccct tccgtcccaa gccgaggttt 241 cctgcccccc agcccctgga caatgctggc ctgttctcct acctcaccgt gtcatggctc 301 accccgctca tgatccaaag cttacggagt cgcttagatg agaacaccat ccctccactg 361 tcagtccatg atgcctcaga caaaaatgtc caaaggcttc accgcctttg ggaagaagaa 421 gtctcaaggc gagggattga aaaagcttca gtgcttctgg tgatgctgag gttccagaga 481 acaaggttga ttttcgatgc acttctgggc atctgcttct gcattgccag tgtactcggg 541 ccaatattga ttataccaaa gatcctggaa tattcagaag agcagttggg gaatgttgtc 601 catggagtgg gactctgctt tgcccttttt ctctccgaat gtgtgaagtc tctgagtttc 661 tcctccagtt ggatcatcaa ccaacgcaca gccatcaggt tccgagcagc tgtttcctcc 721 tttgcctttg agaagctcat ccaatttaag tctgtaatac acatcacctc aggagaggcc 781 atcagcttct tcaccggtga tgtaaactac ctgtttgaag gggtgtgcta tggaccccta 841 gtactgatca cctgcgcatc gctggtcatc tgcagcattt cttcctactt cattattgga 901 tacactgcat ttattgccat cttatgctat ctcctggttt tcccactggc ggtattcatg 961 acaagaatgg ctgtgaaggc tcagcatcac acatctgagg tcagcgacca gcgcatccgt 1021 gtgaccagtg aagttctcac ttgcattaag ctgattaaaa tgtacacatg ggagaaacca 1081 tttgcaaaaa tcattgaaga cctaagaagg aaggaaagga aactattgga gaagtgcggg 1141 cttgtccaga gcctgacaag tataaccttg ttcatcatcc ccacagtggc cacagcggtc 1201 tgggttctca tccacacatc cttaaagctg aaactcacag cgtcaatggc cttcagcatg 1261 ctggcctcct tgaatctcct tcggctgtca gtgttctttg tgcctattgc agtcaaaggt 1321 ctcacgaatt ccaagtctgc agtgatgagg ttcaagaagt ttttcctcca ggagagccct 1381 gttttctatg tccagacatt acaagacccc agcaaagctc tggtctttga ggaggccacc 1441 ttgtcatggc aacagacctg tcccgggatc gtcaatgggg cactggagct ggagaggaac 1501 gggcatgctt ctgaggggat gaccaggcct agagatgccc tcgggccaga ggaagaaggg 1561 aacagcctgg gcccagagtt gcacaagatc aacctggtgg tgtccaaggt agccttgttc 1621 aggccacgca ggcaggccag ctgccaggct ctcaggacct ga "MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWS QQERNPEAPGRAAVPPWGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTP LMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQR TRLIFDALLGICFCIASVLGPILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSL SFSSSWIINQRTAIRFRAAVSSFAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVC YGPLVLITCASLVICSISSYFIIGYTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEV SDQRIRVTSEVLTCIKLIKMYTWEKPFAKIIEDLRRKERKLLEKCGLVQSLTSITLFI IPTVATAVWVLIHTSLKLKLTASMAFSMLASLNLLRLSVFFVPIAVKGLTNSKSAVMR FKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMT RPRDALGPEEEGNSLGPELHKINLVVSKVALFRPRRQASCQALRT" 5 Uitgeverij Malmberg

6 14 Leid uit de gegevens in afbeelding 4 af of de nucleotidenvolgorde is weergegeven van de coderende streng of van de daaraan complementaire matrijsstreng (template-streng) van het gen. Wordt deze streng gebruikt voor transcriptie? Weergave A de coderende streng B de coderende streng C de matrijsstreng D de matrijsstreng Gebruikt voor transcriptie? ja nee ja nee Met behulp van de gegevens in de inleiding en in afbeelding 4 kun je bepalen welk aminozuur, als gevolg van de beschreven puntmutatie in allel N, in het genproduct vervangen wordt door een ander aminozuur. 15 Welk aminozuur wordt vervangen in het genproduct? A arginine B glycine C proline D threonine E valine De Japanse genetici onderzochten een persoon Q die voor het gen voor oorsmeer heterozygoot was, en droog oorsmeer maakte. Eén van de allelen voor oorsmeer van persoon Q had een deletie van 27 nucleotiden (D27) aan de 3 kant van plaats 538. De onderzoekers veronderstelden dat daardoor het translatieproduct van dit allel onwerkzaam zou zijn. 1p 16 Waardoor produceert persoon Q dan droog oorsmeer? In afbeelding 5 zijn van drie ouderparen de genotypes, wat betreft de ABCC11 allelen in chromosoom 16, schematisch weergegeven. De afkortingen G en A staan voor respectievelijk Guanine en Adenine op plaats 538. Met een teken wordt de deletie D27 in dit gen aangegeven en met een + teken de intacte nucleotidenvolgorde. Afbeelding 5 1 vader G + G moeder G + G 2 vader G + A + moeder G A + 3 vader G A + moeder A + A + 17 Welke combinatie geeft of welke combinaties geven mogelijk de ouders van persoon Q weer? A alleen 1 B alleen 2 C alleen 3 D 1 en 2 E 1 en 3 F 2 en 3 Bron: examen vwo Uitgeverij Malmberg

7 Antwoorden en uitleg Erfelijke kaalheid 1 Omdat het om zonen gaat, is er sprake van een hoge concentratie testosteron. Dit betekent dat het allel H k dominant is over het allel H n. Uit de cruising H k H n H k H n komt het volgende nageslacht: 1/4 H k H k : 2/4 H k H n : 1/4 H n H n. 75% van het nageslacht heeft in ieder geval het allel H k en is dus kaal. Het juiste antwoord is dus: E (2 punten). THEMA 4 BASISSTOF 4 2 Na de menopauze stijgt het testosterongehalte. Dit hormoon wordt onder andere door de bijnierschors gemaakt. Het hormoon oestrogeen dat de werking van het mannelijke geslachtshormoon tenietdeed, wordt na de menopauze niet meer gemaakt. Vóór de menopauze was het testosterongehalte dus laag en was het allel H n dominant over het allel H k. Omdat de vrouwen later kaal worden, moeten zij behalve het allel H n ook het allel H k hebben. Het juiste antwoord is dus: B (2 punten). THEMA 4 BASISSTOF 4 Kleurenblindheid 3 Het gaat om de kruising X K X k X K Y. Het kind moet een jongen zijn, want alle meisjes krijgen het dominante allel X K van hun vader en zijn niet kleurenblind. De kans op een jongen die kleurenblind is: 1/2 (Y van de vader) 1/2 (X k van de moeder) 1/7 (kans op heterozygoot) = 1/28. Het juiste antwoord is dus: D (2 punten). THEMA 4 BASISSTOF 5 4 Omdat twee gezonde ouders drie gezonde kinderen en een ziek kind krijgen, wordt de ziekte veroorzaakt door een recessief gen (1 punt). Het gen kan autosomaal (= niet-x-chromosomaal) overerven. Als de grootvader heterozygoot (Aa) is en de grootmoeder homozygoot recessief (aa) dan kunnen de kinderen heterozygoot of ziek zijn, zoals in de stamboom ook is te zien. Het fenotype van de twee ouderparen (tweede generatie) en de kleinkinderen (derde generatie) is op deze manier ook te verklaren. De linkerouders van de tweede generatie zijn ieder heterozygoot en kunnen gezonde en zieke kinderen krijgen. De rechterouders van de tweede generatie zijn aa en AA (of Aa). Hun kinderen kunnen allen gezond zijn door het dominante allel A van de moeder. Als de ziekte X-chromosomaal overerft, dan klopt de stamboom ook. De grootouders zijn dan X a X a en X A Y. De zonen zijn dan ziek (X a Y) en de dochters gezond(x A X a ). Ook voor de volgende generatie klopt het. De ouders met de vier kinderen zijn dan X A Y en X A X a. De dochters zijn gezond (zij hebben altijd de X A van hun vader) en de zonen kunnen gezond (X A Y) of ziek zijn (X a Y). De rechterouders zijn dan X a Y en X A X A (of X A X a ). Hun kinderen zijn dan gezond door het dominante allel van de moeder (X A ). Het juiste antwoord is dus dat het niet is af te leiden of het gen X-chromosomaal of niet X-chromosomaal is (1 punt). THEMA 4 BASISSTOF Uitgeverij Malmberg

8 Man of vrouw? 5 Uit het antwoord moet blijken dat: het allel voor ADS dat bij haar overgrootvader voorkomt, via haar beide grootouders (nummers 4 en 5) en beide ouders (nummers 7 en 8) in Calliope is terechtgekomen ( 1 punt); zodat Calliope homozygoot is voor het recessieve allel (en de afwijking zich openbaart) (1 punt). THEMA 4 BASISSTOF 9 6 Uit het antwoord moet blijken dat het afwijkende (X-chromosomale) allel bij haar overgrootvader tot onvruchtbaarheid zou hebben geleid / tot een vrouwelijk fenotype zou hebben geleid, waardoor haar grootouders niet geboren zouden zijn (en Calliope dus niet zou bestaan) (1 punt). THEMA 4 BASISSTOF 9 Spierdystrofie 7 Het gen is recessief (1 punt). In een juiste uitleg wordt vermeld dat uit de stamboom blijkt dat ouders die de spierziekte niet hebben, een kind met deze spierziekte kunnen krijgen (1 punt). THEMA 4 BASISSTOF 4 8 De ziekte is X-chromosomaal, omdat meer jongens dan meisjes de ziekte hebben (1 punt). THEMA 4 BASISSTOF 5 Erfelijke informatie 9 Zie Binas. Het gaat om het mrna UCUCUCUCUC enzovoort. Dit betekent dat er twee codons UCU en CUC beschikbaar zijn voor translatie. Uit Binas blijkt dat zij coderen voor de aminozuren serine en leucine. Het juist antwoord is dus: D (2 punten). 10 We gaan weer uit van de mrna streng UCUCUCUCUC enzovoort. Bij een code van vier nucleotiden is er sprake van maar één aminozuur, namelijk het aminozuur dat hoort bij UCUC. Het juiste antwoord is dus: A (2 punten). 8 Uitgeverij Malmberg

9 11 De 5 -kant is rechts (1 punt), want dat is de kant waar zich het startcodon (AUG) bevindt / want als de 5 -kant links zou zijn, is UAA een stopcodon waardoor er geen zes aminozuren worden gecodeerd (1 punt). Oorsmeer 12 Zie Binas. AGT levert een codon op van AGU met als aminozuur Serine (ser). AGA levert een codon op van AGA en een aminozuur Arginine (arg). AGC levert een codon op van AGC en een aminozuur ser. AGG levert een codon op van AGG en een aminozuur arg. De substitutie van het derde nucleotide T in C verandert het aminozuur dus niet. Het juiste antwoord is dus: B (2 punten). 13 Door de verandering in de aminozuurvolgorde / de primaire structuur verandert de ruimtelijke / tertiaire structuur van (de actieve plaats van) het eiwit (1 punt) waardoor een bepaalde stof die nodig is bij de vorming van oorsmeer niet meer wordt opgenomen / afgegeven (met als gevolg een veranderde samenstelling van het oorsmeer) (1 punt). 14 Het eerste triplet ATG behoort tot de coderende streng. De template-streng zou AUG als eerste triplet hebben voor het aminozuur M (methionine). De coderende streng wordt dus niet gebruikt voor de transcriptie, want dit zou AUG moeten zijn. Het juiste antwoord is dus: B (2 punten). HEMA 4 BASISSTOF 8 15 Zie Binas. Op plaats 538 wordt G vervangen door A. Kijk op het einde van de regel die begint met 481! Het triplet verandert dus van GGG in AGG. Het oorspronkelijke triplet in de template-streng is CCC en het oorspronkelijke codon GGG. Dit betekent dat het genproduct glycine is vervangen. Het juiste antwoord is dus: B (2 punten). 16 Het andere (recessieve) allel dat codeert voor droog oorsmeer is intact / Deze persoon bezit geen allel N (1 punt). THEMA 4 BASISSTOF 4 17 Persoon Q heeft als genotype G A +. Ouders 1 vallen direct af, omdat zij geen allel hebben voor droog oorsmeer. Daarvoor is A + nodig. Ouders 2 en 3 hebben beiden de mogelijkheid om G en A + te geven aan hun kind. Het juiste antwoord is dus: F (2 punten). THEMA 4 BASISSTOF 6 9 Uitgeverij Malmberg

CE toets HAVO (1) erfelijkheid

CE toets HAVO (1) erfelijkheid CE toets HAVO (1) erfelijkheid Schelpen Afbeelding 3 (zie de bron Schelpen) is een foto van schelpen van Argopecten irradians, een kamschelpsoort. Deze schelpdieren leven in de Atlantische oceaan langs

Nadere informatie

4 HAVO thema 4 Erfelijkheid EXAMENTRAINER OEFENVRAGEN

4 HAVO thema 4 Erfelijkheid EXAMENTRAINER OEFENVRAGEN Examentrainer Vragen Karyogrammen In afbeelding 1 zijn twee karyogrammen weergegeven. Deze karyogrammen zijn afkomstig van een eeneiige tweeling. Het ene kind is van het mannelijk geslacht zonder duidelijke

Nadere informatie

28 Testkruising testkruising = een kruising om te achterhalen of een organisme homozygoot of heterozygoot is. Voorbeeld van een testkruising om te bepalen of een organisme homozygoot of heterozygoot is

Nadere informatie

Hetzelfde DNA in elke cel

Hetzelfde DNA in elke cel EIWITSYNTHESE (H18) Hetzelfde DNA in elke cel 2 Structuur en functie van DNA (1) Genen bestaan uit DNA Genen worden gedragen door chromosomen Chromosomen bestaan uit DNAmoleculen samengepakt met eiwitten

Nadere informatie

Level 1. Vul het juiste woord in

Level 1. Vul het juiste woord in Level 1 Vul het juiste woord in Keuze uit: Gen, Allel, Locus, Dominant, Recessief, Co-dominantie, Monohybride kruising, Dihybride kruising, Autosoom, Autosomale overerving, X-chromosomale overerving, Intermediair

Nadere informatie

Voorbereiding toelatingsexamen arts/tandarts. Biologie: Erfelijkheid 6/29/2013. dr. Brenda Casteleyn

Voorbereiding toelatingsexamen arts/tandarts. Biologie: Erfelijkheid 6/29/2013. dr. Brenda Casteleyn Voorbereiding toelatingsexamen arts/tandarts Biologie: Erfelijkheid 6/29/2013 dr. Brenda Casteleyn Met dank aan: Leen Goyens (http://users.telenet.be/toelating) en studenten van forum http://www.toelatingsexamen-geneeskunde.be

Nadere informatie

vwo erfelijkheid 2010

vwo erfelijkheid 2010 vwo erfelijkheid 2010 Bijengenetica Een bijenvolk bestaat uit: de koningin (een vruchtbaar vrouwtje), een groot aantal werksters (steriele vrouwtjes) en darren (mannetjes). Alle vrouwtjes zijn diploïd

Nadere informatie

ANTWOORDEN HOOFDSTUK 6 VAN GEN TOT EIWIT

ANTWOORDEN HOOFDSTUK 6 VAN GEN TOT EIWIT ANTWOORDEN HOOFDSTUK 6 VAN GEN TOT EIWIT ANTWOORDEN 6.5 /TM 6.8 Codering 1.een juiste aanvulling van het schema : nucleotiden in mrna juist nucleotiden in DNA juist 3 kant en 5 kant bij mrna en DNA juist

Nadere informatie

AAbb of Aabb = normaal zicht aabb of aabb = retinitis pigmentosa AABB of AABb = retinitis pigmentosa

AAbb of Aabb = normaal zicht aabb of aabb = retinitis pigmentosa AABB of AABb = retinitis pigmentosa 13. (MC) Retinitis pigmentosa is een erfelijke vorm van blindheid, die kan veroorzaakt worden door een recessief allel (a) op een locus alfa, of door een dominant allel (B) op een andere locus, bèta. Onderstaande

Nadere informatie

Tentamen Van Mens tot Cel

Tentamen Van Mens tot Cel Tentamen Van Mens tot Cel 1. Hans en Tineke willen graag een kindje. Zowel de ouders van Hans als de ouders van Tineke zijn beide drager van een autosomaal recessieve ziekte. Wat is de kans dat Hans en

Nadere informatie

vwo eiwitsynthese 2010

vwo eiwitsynthese 2010 vwo eiwitsynthese 2010 Aan- en uitzetten van genen Escherichia coli leeft in de dikke darm van onder andere de mens. Deze bacterie heeft vijf structurele genen die coderen voor enzymen die betrokken zijn

Nadere informatie

Level 1. Vul het juiste woord in

Level 1. Vul het juiste woord in Level 1 Vul het juiste woord in Keuze uit: Gen, Allel, Locus, Dominant, Recessief, Co-dominantie, Monohybride kruising, Dihybride kruising, Autosoom, Autosomale overerving, X-chromosomale overerving, Intermediair

Nadere informatie

2 Leg uit hoe de verschillende subtypes van Chlamydia trachomatis zijn ontstaan. Beschrijf de rol van antibioticagebruik hierin.

2 Leg uit hoe de verschillende subtypes van Chlamydia trachomatis zijn ontstaan. Beschrijf de rol van antibioticagebruik hierin. Examentrainer Vragen Nieuwe DNA-test voor chlamydia Chlamydia is de meest voorkomende seksueel overdraagbare aandoening (soa) en kan onder meer leiden tot onvruchtbaarheid. In Nederland worden jaarlijks

Nadere informatie

Van mens tot Cel oefenvragen 1. De celdeling bestaat uit verschillende fasen. Hoe heten de G1, S en de G2 fase samen?

Van mens tot Cel oefenvragen 1. De celdeling bestaat uit verschillende fasen. Hoe heten de G1, S en de G2 fase samen? Van mens tot Cel oefenvragen 1. De celdeling bestaat uit verschillende fasen. Hoe heten de G1, S en de G2 fase samen? A: interfase B: profase C: anafase D: cytokinese 2. Een SNP (single nucleotide polymorphism)

Nadere informatie

Vraag /144. Vraag 14

Vraag /144. Vraag 14 Vraag 13 107/144 De kinderen van Romeo en Julia kunnen de ziekte enkel hebben indien hun beide ouders heterozygoot zijn. Hoe groot is die kans? Julia's broer Augusto heeft de ziekte, dus moeten zowel Laura

Nadere informatie

Let er op dat je voor iedere vraag een uitwerking maakt met kruisingsschema en/of berekening.

Let er op dat je voor iedere vraag een uitwerking maakt met kruisingsschema en/of berekening. Week Thema Onderwerp Datum 43 3 Basisstof 1 t/m 4 23/10 28/10 44 3 Basisstof 1 t/m 4 31/10 4/11 45 7/11 11/11 Basisstof 5 t/m 7 bespreken 3 Basisstof 5 t/m 7 bespreken Verrijkingsstof 1 Herhalen en bespreken

Nadere informatie

Biologie 2000 Vraag 1 De plaats waar de chromatiden van een chromosoom tijdens de eerste fasen van een cel/kerndeling aan mekaar vastzitten noemt men: A. Centriool B. Centromeer C. Centrosoom D. Chromomeer

Nadere informatie

Examen Voorbereiding Erfelijkheid

Examen Voorbereiding Erfelijkheid Examen Voorbereiding Erfelijkheid Teylingen College Leeuwenhorst 2015/2016 Thema 4 Erfelijkheid Begrippenlijst: Begrip DNA-sequentie Genexpressie Epigenetica Homozygoot Heterozygoot Intermediair Monohybride

Nadere informatie

HERKANSINGSTENTAMEN Moleculaire Biologie deel 2, 5 Jan 2007

HERKANSINGSTENTAMEN Moleculaire Biologie deel 2, 5 Jan 2007 HERKANSINGSTENTAMEN Moleculaire Biologie deel 2, 5 Jan 2007 NAAM: STUDENTNUMMER: CONTROLEER OF DIT TENTAMEN 14 PAGINA S BEVAT. Veel succes! o Je mag de achterkant van het papier ook zo nodig gebruiken,

Nadere informatie

Biologie 1997 Augustus

Biologie 1997 Augustus www. Biologie 1997 Augustus Vraag 1 In de onderstaande tekening is de elektronenmicroscopische afbeelding van een cel van een traanklier van een mens weergegeven. Het afgescheiden traanvocht bevat een

Nadere informatie

Mendel en Morgan versie 2009-2010

Mendel en Morgan versie 2009-2010 Mendel en Morgan versie 2009-2010 Vragen bij COO over hoofdstuk 14 en 15 van Campbells Biology, 8e druk De vragen in dit COO-programma zijn vaak gebaseerd op random gegenereerde gegevens. Behalve de antwoorden

Nadere informatie

94 Transcriptie en vorming van mrna bij prokaryoten en eukaryoten

94 Transcriptie en vorming van mrna bij prokaryoten en eukaryoten 94 Transcriptie en vorming van mrna bij prokaryoten en eukaryoten Transcriptie bij prokaryoten: Prokaryoten hebben geen celkern, waardoor het DNA los in het cytoplasma ligt. Hier vindt de transcriptie

Nadere informatie

Samenvattingen. Samenvatting Thema 4: Erfelijkheid. Basisstof 1. Basisstof 2. Erfelijke eigenschappen:

Samenvattingen. Samenvatting Thema 4: Erfelijkheid. Basisstof 1. Basisstof 2. Erfelijke eigenschappen: Samenvatting Thema 4: Erfelijkheid Basisstof 1 Erfelijke eigenschappen: - Genotype: o genen liggen op de chromosomen in kernen van alle cellen o wordt bepaald op moment van de bevruchting - Fenotype: o

Nadere informatie

Erfelijkheid van de ziekte van Huntington

Erfelijkheid van de ziekte van Huntington Erfelijkheid van de ziekte van Huntington In de kern van iedere cel van het menselijk lichaam is uniek erfelijk materiaal opgeslagen. Dit erfelijk materiaal wordt ook wel DNA (Desoxyribonucleïnezuur) genoemd.

Nadere informatie

Afsluitende les. Leerlingenhandleiding. Wat voor eiwit ben jij? (Basis)

Afsluitende les. Leerlingenhandleiding. Wat voor eiwit ben jij? (Basis) Afsluitende les Leerlingenhandleiding Wat voor eiwit ben jij? (Basis) Deel 1 In het DNA ligt het erfelijk materiaal van een organisme in code opgeslagen. Deze code is opgebouwd uit vier nucleotiden: adenosine

Nadere informatie

Fenotype nakomelingen. donker kort 29 donker lang 9 wit kort 31 wit- lang 11

Fenotype nakomelingen. donker kort 29 donker lang 9 wit kort 31 wit- lang 11 1. Bij honden is het allel voor donkerbruine haarkleur (E) dominant over het allel voor witte haarkleur (e). Het allel voor kort haar (F) is dominant over het allel voor lang haar (f). Een aantal malen

Nadere informatie

<A> Thymine is een pyrimidinebase en vormt 3 waterstofbruggen met adenine. <B> Adenine is een purinebase en vormt 2 waterstofbruggen met thymine.

<A> Thymine is een pyrimidinebase en vormt 3 waterstofbruggen met adenine. <B> Adenine is een purinebase en vormt 2 waterstofbruggen met thymine. Biologie Vraag 1 Welke uitspraak is correct? Thymine is een pyrimidinebase en vormt 3 waterstofbruggen met adenine. Adenine is een purinebase en vormt 2 waterstofbruggen met thymine. Cytosine

Nadere informatie

<A> Adenine is een purinebase en vormt 2 waterstofbruggen met thymine. <B> Guanine is een pyrimidinebase en vormt 2 waterstofbruggen met cytosine.

<A> Adenine is een purinebase en vormt 2 waterstofbruggen met thymine. <B> Guanine is een pyrimidinebase en vormt 2 waterstofbruggen met cytosine. Biologie Vraag 1 Welke uitspraak is correct? Adenine is een purinebase en vormt 2 waterstofbruggen met thymine. Guanine is een pyrimidinebase en vormt 2 waterstofbruggen met cytosine. Thymine

Nadere informatie

DNA & eiwitsynthese Oefen- en zelftoetsmodule behorende bij hoofdstuk 16 en 17 van Campbell, 7 e druk December 2008

DNA & eiwitsynthese Oefen- en zelftoetsmodule behorende bij hoofdstuk 16 en 17 van Campbell, 7 e druk December 2008 DNA & eiwitsynthese Oefen- en zelftoetsmodule behorende bij hoofdstuk 16 en 17 van Campbell, 7 e druk December 2008 DNA 1. Hieronder zie je de schematische weergave van een dubbelstrengs DNA-keten. Een

Nadere informatie

2. Erfelijkheid en de ziekte van Huntington

2. Erfelijkheid en de ziekte van Huntington 2. Erfelijkheid en de ziekte van Huntington Erfelijkheid Erfelijk materiaal in de 46 chromosomen De mens heeft in de kern van elke lichaamscel 46 chromosomen: het gaat om 22 paar lichaamsbepalende chromosomen

Nadere informatie

Grootste examentrainer en huiswerkbegeleider van Nederland. Biologie. Trainingsmateriaal. De slimste bijbaan van Nederland! lyceo.

Grootste examentrainer en huiswerkbegeleider van Nederland. Biologie. Trainingsmateriaal. De slimste bijbaan van Nederland! lyceo. Grootste examentrainer en huiswerkbegeleider van Nederland Biologie Trainingsmateriaal De slimste bijbaan van Nederland! lyceo.nl Traininingsmateriaal Biologie Lyceo-trainingsdag 2015 Jij staat op het

Nadere informatie

1 Antwoorden Monohybride Kruisingen

1 Antwoorden Monohybride Kruisingen 1 Antwoorden Monohybride Kruisingen 1) A = zwart haar, a = wit haar P: Aa x Aa F1: A a A AA Aa Alleen genotype aa geeft wit haar, dus 25 % 2) a) Eigenschap C (= A) b) Aa c) Aa d) AA of Aa 3) zwart : wit

Nadere informatie

Examen Voorbereiding DNA. Teylingen College Leeuwenhorst 2015/2016. 2016 JasperOut.nl. Thema 2 DNA

Examen Voorbereiding DNA. Teylingen College Leeuwenhorst 2015/2016. 2016 JasperOut.nl. Thema 2 DNA Examen Voorbereiding DNA Teylingen College Leeuwenhorst 2015/2016 Thema 2 DNA Begrippenlijst: Begrip mtdna kerndna Plasmiden Genoom DNA-replicatie DNA-polymerase Eiwitsynthese RNA-molecuul Codon Genregulatie

Nadere informatie

BIOLOGIE MOLECULAIRE GENETICA EIWITSYNTHESE VWO KLASSE 6

BIOLOGIE MOLECULAIRE GENETICA EIWITSYNTHESE VWO KLASSE 6 BIOLOGIE MOLECULAIRE GENETICA EIWITSYNTHESE VWO KLASSE 6 Henry N. Hassankhan Scholengemeenschap Lelydorp [HHS-SGL] ARTHUR A. HOOGENDOORN ATHENEUM - VRIJE ATHENEUM - AAHA Docent: A. Sewsahai DOELSTELLINGEN:

Nadere informatie

biologie vwo 2016-I Onderzoek naar aneurysma s

biologie vwo 2016-I Onderzoek naar aneurysma s Onderzoek naar aneurysma s Genetici van vijf Nederlandse universiteiten hebben samen een erfelijke oorzaak gevonden voor het ontstaan van verwijdingen in de aorta. Door mensen uit risicofamilies voortaan

Nadere informatie

Spierziekten en genetica

Spierziekten en genetica Susan Peters, MSc Spierziekten en genetica Chromosomen en genen Ons lichaam is opgebouwd uit miljarden cellen. Zij ontstaan door celdeling. Eerst is er alleen een bevruchte eicel. Deze deelt zich in tweeën,

Nadere informatie

Afsluitende les. Leerlingenhandleiding. Wat voor eiwit ben jij? (Basis)

Afsluitende les. Leerlingenhandleiding. Wat voor eiwit ben jij? (Basis) Afsluitende les Leerlingenhandleiding Wat voor eiwit ben jij? (Basis) Deel 1 In het DNA ligt het erfelijk materiaal van een organisme in code opgeslagen. Deze code is opgebouwd uit vier nucleotiden: adenosine

Nadere informatie

Welke van de bovenstaande celorganellen of levensprocessen kunnen zowel in prokaryote, als in eukaryote cellen voorkomen?

Welke van de bovenstaande celorganellen of levensprocessen kunnen zowel in prokaryote, als in eukaryote cellen voorkomen? Biologie Vraag 1 Celorganellen en levensprocessen bij levende cellen zijn: 1. Ribosomen 2. ATP synthese 5. DNA polymerase 3. Celmembranen 6. Fotosynthese 4. Kernmembraan 7. Mitochondria Welke van de bovenstaande

Nadere informatie

STEMPEL DE WEG VAN GEN NAAR EIWIT

STEMPEL DE WEG VAN GEN NAAR EIWIT A LIFE TYPEFACE STEMPEL DE WEG VAN GEN NAAR EIWIT De eiwitsynthese is één van de belangrijkste processen die zich in de cel afspelen. Eiwitten staan aan de basis van het functioneren van de cel. Wat een

Nadere informatie

Erfelijkheid. Examen VMBO-GL en TL. biologie CSE GL en TL. Bij dit examen hoort een bijlage.

Erfelijkheid. Examen VMBO-GL en TL. biologie CSE GL en TL. Bij dit examen hoort een bijlage. Examen VMBO-GL en TL Erfelijkheid biologie CSE GL en TL Bij dit examen hoort een bijlage. Dit examen bestaat uit 26 vragen. Voor dit examen zijn maximaal 30 punten te behalen. Voor elk vraagnummer staat

Nadere informatie

Voorbereiding toelatingsexamen arts/tandarts. Biologie: Erfelijke informatie in de cel 6/29/2013. dr. Brenda Casteleyn

Voorbereiding toelatingsexamen arts/tandarts. Biologie: Erfelijke informatie in de cel 6/29/2013. dr. Brenda Casteleyn Voorbereiding toelatingsexamen arts/tandarts Biologie: Erfelijke informatie in de cel 6/29/2013 dr. Brenda Casteleyn Met dank aan: Leen Goyens (http://users.telenet.be/toelating) en studenten van forum

Nadere informatie

Tentamen Genetica 22-10-2004 Studentnr:

Tentamen Genetica 22-10-2004 Studentnr: CONTROLEER OF DIT TENTAMEN 11 PAGINA S BEVAT. Veel succes! Je mag de achterkant van het papier ook zo nodig gebruiken, maar beantwoord vragen 1-6 niet op blaadjes van vraag 7 en de daarop volgende. 1.

Nadere informatie

Welke van de bovenstaande celorganellen of levensprocessen kunnen zowel in prokaryote, als in eukaryote cellen voorkomen?

Welke van de bovenstaande celorganellen of levensprocessen kunnen zowel in prokaryote, als in eukaryote cellen voorkomen? Biologie Vraag 1 Celorganellen en levensprocessen bij levende cellen zijn: 1. Ribosomen 2. ATP synthese 5. DNA polymerase 3. Celmembranen 6. Fotosynthese 4. Kernmembraan 7. Mitochondria Welke van de bovenstaande

Nadere informatie

ERFELIJKHEID. 1 N i e t a l l e m a a l h e t z e l f d e Afbeelding 17-2

ERFELIJKHEID. 1 N i e t a l l e m a a l h e t z e l f d e Afbeelding 17-2 ERFELIJKHEID 1 N i e t a l l e m a a l h e t z e l f d e Afbeelding 17-2 Afbeelding 17-1 Mensen uit elkaar houden vind je vast makkelijker. Toch hebben ook mensen veel meer overeenkomsten dan verschillen.

Nadere informatie

Vraag Welk van de onderstaande beweringen over deze F 2 zijn juist?

Vraag Welk van de onderstaande beweringen over deze F 2 zijn juist? Opgave 1: Zijdeachtige veren Op vogeltentoonstellingen worden regelmatig geshowd met zogenoemde zijdeachtige veren. Deze afwijking van de normale veerstructuur wordt veroorzaakt door een recessief allel.

Nadere informatie

DNA & eiwitsynthese Vragen bij COO-programma bij hoofdstuk 11 en 12 Life

DNA & eiwitsynthese Vragen bij COO-programma bij hoofdstuk 11 en 12 Life DNA & eiwitsynthese Vragen bij COO-programma bij hoofdstuk 11 en 12 Life De vragen die voorkomen in het COO-programma DNA & eiwitsynthese zijn op dit formulier weergegeven. Het is de bedoeling dat je,

Nadere informatie

Dialogen voor conceptcartoons. Verband genotype/fenotype, dominant/recessief

Dialogen voor conceptcartoons. Verband genotype/fenotype, dominant/recessief Dialogen voor conceptcartoons Verband genotype/fenotype, dominant/recessief 1 Is dit ons kind? (Zie conceptcartoon Horst Wolter op deze site.) Leermoeilijkheid (misconcept): Uiterlijke eigenschappen weerspiegelen

Nadere informatie

Copyright 2008 Pearson Education Inc., publishing as Pearson Benjamin Cummings

Copyright 2008 Pearson Education Inc., publishing as Pearson Benjamin Cummings De meeste organismen hebben een twee sets chromosomen, met daarop informatie voor alle eigenschappen van dat organisme (diploid) Deze erfelijke informatie noemen we het genotype Hoe deze erfelijke informatie

Nadere informatie

Genetische Selectie. Eindwerk: hondenfokker 2 de jaar. Sabine Spiltijns

Genetische Selectie. Eindwerk: hondenfokker 2 de jaar. Sabine Spiltijns Genetische Selectie Eindwerk: hondenfokker 2 de jaar Sabine Spiltijns 2010-2011 0 We kunnen aan de hand van een genetische selectie ongeveer voorspellen hoe de puppy s van onze hondjes er gaan uitzien.

Nadere informatie

ERFELIJKHEID EN ZIEKTE. H.H. TAN, arts 2015

ERFELIJKHEID EN ZIEKTE. H.H. TAN, arts 2015 ERFELIJKHEID EN ZIEKTE H.H. TAN, arts 2015 1B ERFELIJKHEID EN ZIEKTE 2 DNA (Desoxyribo Nucleïnezuur (acid)) - Bestaat uit 2 nucleotide ketens, - Bevat 4 basen: A = adenine C = cytosine - Is opgerold tot

Nadere informatie

Copyright 2008 Pearson Education Inc., publishing as Pearson Benjamin Cummings

Copyright 2008 Pearson Education Inc., publishing as Pearson Benjamin Cummings De meeste organismen hebben een twee sets chromosomen, met daarop informatie voor alle eigenschappen van dat organisme (diploid) Deze erfelijke informatie noemen we het genotype Hoe deze erfelijke informatie

Nadere informatie

Oplossingen Biologie van 2000

Oplossingen Biologie van 2000 www. Oplossingen Biologie van 2000 Disclaimer: Alle uitwerkingen zijn onder voorbehoud van eventuele fouten. Er is geen enkele aansprakelijkheid bij de auteur van deze documenten. Vraag 1 Om deze vraag

Nadere informatie

Het enzym dat verantwoordelijk is voor het vastleggen van de imprint na de DNA-replicatie is een DNA-methyltransferase.

Het enzym dat verantwoordelijk is voor het vastleggen van de imprint na de DNA-replicatie is een DNA-methyltransferase. Examentrainer Vragen Hongerwinterkinderen Gedurende de laatste winter van de Tweede Wereldoorlog stierven veel Nederlanders door barre omstandigheden: koude en voedselgebrek. Tijdens deze hongerwinter

Nadere informatie

Welke combinatie van twee celorganellen en hun respectievelijke functies is correct?

Welke combinatie van twee celorganellen en hun respectievelijke functies is correct? Biologie Vraag 1 Welke combinatie van twee celorganellen en hun respectievelijke functies is correct? ribosoom en synthese van eiwitten kern en fotosynthese mitochondrion en fotosynthese ribosoom

Nadere informatie

Biologie (jaartal onbekend)

Biologie (jaartal onbekend) Biologie (jaartal onbekend) 1) Bijgevoegde fotografische afbeelding geeft de elektronenmicroscopische opname van een organel (P) van een cel. Wat is de belangrijkste functie van dit organel? A. Het transporteren

Nadere informatie

Erfelijkheidsschema's deel 1.

Erfelijkheidsschema's deel 1. Erfelijkheidsschema's deel 1. Theorie: o Elke cel bevat 2n chromosomen. n = aantal verschillende chromosomen. Bij mensen is n=23 en dus zitten in elke lichaamscel 23 paar (46) chromosomen. Eén deel kreeg

Nadere informatie

Oefenvraagstukken genetica

Oefenvraagstukken genetica Oefenvraagstukken genetica Monohybride kruisingen. 50 meerkeuze vragen. OPLOSSEN MET KRUISSINGSSCHEMA!!!!! 1. Poes Kitty met lange haren heeft gepaard met kater Kobus. Zij krijgt zowel kortharige als langharige

Nadere informatie

V6 Oefenopgaven oktober 2009

V6 Oefenopgaven oktober 2009 V6 Oefenopgaven oktober 2009 Fitness Met fitness wordt in de biologie bedoeld het vermogen van genotypen om hun allelen naar de volgende generatie over te dragen. De fitness wordt uitgedrukt in een getal

Nadere informatie

STEMPEL DE WEG VAN GEN NAAR EIWIT

STEMPEL DE WEG VAN GEN NAAR EIWIT A LIFE TYPEFACE STEMPEL DE WEG VAN GEN NAAR EIWIT De eiwitsynthese is één van de belangrijkste processen die zich in de cel afspelen. Eiwitten staan aan de basis van het functioneren van de cel. Wat een

Nadere informatie

BIOKLOK DE BIOLOGISCHE KLOK IN DE LES MODULE B VWO. klok. www. bio. .nl

BIOKLOK DE BIOLOGISCHE KLOK IN DE LES MODULE B VWO. klok. www. bio. .nl BIOKLOK DE BIOLOGISCHE KLOK IN DE LES MODULE B VWO www. bio klok.nl BIOKLOK MODULE B VWO VERSTOORDE CHRONOTYPES INLEIDING Als het goed is, heb je een vragenlijst ingevuld om te testen of je een ochtendmens

Nadere informatie

Welke van de bovenstaande celorganellen of levensprocessen kunnen zowel in prokaryote, als in eukaryote cellen voorkomen?

Welke van de bovenstaande celorganellen of levensprocessen kunnen zowel in prokaryote, als in eukaryote cellen voorkomen? Biologie Vraag 1 Celorganellen en levensprocessen bij levende cellen zijn: 1. Ribosomen 2. ATP synthese 5. DNA polymerase 3. Celmembranen 6. Fotosynthese 4. Kernmembraan 7. Mitochondria Welke van de bovenstaande

Nadere informatie

Examentraining onderwerp: diagrammen Lees eerst de vraag. ga dan naar de tekst! onderwerp: Bloedsomloop Lees eerst de vraag. ga dan naar de tekst!

Examentraining onderwerp: diagrammen Lees eerst de vraag. ga dan naar de tekst! onderwerp: Bloedsomloop Lees eerst de vraag. ga dan naar de tekst! Examentraining onderwerp: diagrammen Moet er een diagram getekend worden? Bedenk: Welk type grafiek is er nodig. Is het een Lijndiagram? bedenk dan: wat komt er op de X-as? (de onafhankelijke variabele,

Nadere informatie

Juli blauw Biologie Vraag 1

Juli blauw Biologie Vraag 1 Biologie Vraag 1 Bij bijen komt parthenogenese voor. Dit is de ontwikkeling van een individu uit een onbevruchte eicel. Bij bijen ontstaan de darren (mannelijke bijen) parthenogenetisch. De koningin en

Nadere informatie

Juli geel Biologie Vraag 1

Juli geel Biologie Vraag 1 Biologie Vraag 1 Bij bijen komt parthenogenese voor. Dit is de ontwikkeling van een individu uit een onbevruchte eicel. Bij bijen ontstaan de darren (mannelijke bijen) parthenogenetisch. De koningin en

Nadere informatie

Begrippenlijst DNA adenine Eén van de nucelotidebasen die in DNA en RNA voorkomen. Adenine (A) vormt een basenpaar met thymine (T) in het DNA en met

Begrippenlijst DNA adenine Eén van de nucelotidebasen die in DNA en RNA voorkomen. Adenine (A) vormt een basenpaar met thymine (T) in het DNA en met Begrippenlijst DNA adenine Eén van de nucelotidebasen die in DNA en RNA voorkomen. Adenine (A) vormt een basenpaar met thymine (T) in het DNA en met uracil (U) in RNA. Adenine komt ook voor in AMP, ADP,

Nadere informatie

Newsletter April 2013

Newsletter April 2013 1. Inleiding Met het thema van deze nieuwsbrief willen we ons richten op de fundamenten van het fokken: de basisgenetica. Want of je het nu wil of niet. dit is ook de basis voor een succesvolle fok! Misschien

Nadere informatie

van de cel Bioinformatica het probleem Inleiding Medisch Technische Wetenschappen Bioinformatica Deel 1 Celbiologie Elementaire celbiologie

van de cel Bioinformatica het probleem Inleiding Medisch Technische Wetenschappen Bioinformatica Deel 1 Celbiologie Elementaire celbiologie Bioinformatica het probleem Inleiding Medisch Technische Wetenschappen Bioinformatica Deel 1 Michael Egmont-Petersen Watisdebetekenis [in brede zin] van het menselijk genome? Welke structuur hebben de

Nadere informatie

Paragraaf Homologe chromosomen

Paragraaf Homologe chromosomen Paragraaf Homologe chromosomen Opbouw: Lees de les op biologielessn.nl over homologe chromosomen goed door. Maak de onderstaande vragen van deze bladzijde. Reproductie vragen: 1. Wat zijn homologe chromosomen?

Nadere informatie

HAVO 5 Begrippenlijst Erfelijkheid allel Allelen zijn verschillende vormen van een gen. Zij liggen in homologe chromosomen op precies dezelfde

HAVO 5 Begrippenlijst Erfelijkheid allel Allelen zijn verschillende vormen van een gen. Zij liggen in homologe chromosomen op precies dezelfde HAVO 5 Begrippenlijst Erfelijkheid allel Allelen zijn verschillende vormen van een gen. Zij liggen in homologe chromosomen op precies dezelfde plaats. Allelen coderen voor dezelfde eigenschap bijvoorbeeld

Nadere informatie

Inzicht hebben in veel voorkomende patronen van overerving. Professor Martina Cornel and professor Heather Skirton Gen-Equip Project

Inzicht hebben in veel voorkomende patronen van overerving. Professor Martina Cornel and professor Heather Skirton Gen-Equip Project Inzicht hebben in veel voorkomende patronen van overerving Professor Martina Cornel and professor Heather Skirton Gen-Equip Project Leerdoelen Inzicht hebben in de drie belangrijkste patronen van overerving

Nadere informatie

Klinische Genetica. Autosomaal recessieve overerving

Klinische Genetica. Autosomaal recessieve overerving Klinische Genetica Autosomaal recessieve overerving Klinische Genetica U of uw kind is doorverwezen naar de polikliniek Klinische Genetica. Tijdens de afspraak legt een klinisch geneticus of een genetisch

Nadere informatie

Monohybride en dihybride kruisingen vmbo-kgt34

Monohybride en dihybride kruisingen vmbo-kgt34 Auteur VO-content Laatst gewijzigd Licentie Webadres 19 July 2016 CC Naamsvermelding-GelijkDelen 3.0 Nederland licentie http://maken.wikiwijs.nl/63372 Dit lesmateriaal is gemaakt met Wikiwijsleermiddelenplein.

Nadere informatie

Eindexamen biologie vwo 2007-I

Eindexamen biologie vwo 2007-I Beoordelingsmodel Aan het juiste antwoord op een meerkeuzevraag worden twee punten toegekend. Lemmingen 1 maximumscore 1 (ten minste) 2,5/2,6/2,7 ha 2 maximumscore 2 voorbeelden van juiste argumenten:

Nadere informatie

biologie vwo 2015-I Testen op sikkelcelziekte

biologie vwo 2015-I Testen op sikkelcelziekte Testen op sikkelcelziekte Sikkelcelziekte is een aandoening aan de rode bloedcellen. Het gen voor de ziekte erft autosomaal recessief over en berust op een puntmutatie in het β-globinegen. In Nederland

Nadere informatie

BIOKLOK DE BIOLOGISCHE KLOK IN DE LES MODULE B HAVO. klok. www. bio. .nl

BIOKLOK DE BIOLOGISCHE KLOK IN DE LES MODULE B HAVO. klok. www. bio. .nl BIOKLOK DE BIOLOGISCHE KLOK IN DE LES MODULE B HAVO www. bio klok.nl BIOKLOK MODULE B HAVO VERSTOORDE CHRONOTYPES INLEIDING Als het goed is, heb je een vragenlijst ingevuld om te testen of je een ochtendmens

Nadere informatie

Leerlingenhandleiding

Leerlingenhandleiding Leerlingenhandleiding Niveau: basis Bioinformatica: leven in de computer Ontwikkeld door het Netherlands Bioinformatics Centre in samenwerking met het Centre for Molecular and Biomolecular Informatics

Nadere informatie

Fragiele-Xsyndroom. Een erfelijke aandoening

Fragiele-Xsyndroom. Een erfelijke aandoening Fragiele-Xsyndroom Een erfelijke aandoening Het fragiele-x-syndroom is, een erfelijke aandoening, die gepaard gaat met een verstandelijke handicap, op autisme gelijkend gedrag en dikwijls bepaalde uiterlijke

Nadere informatie

Dan is de waarde van het recessieve allel q dus 0,87, vanwege het feit dat p + q = 1.

Dan is de waarde van het recessieve allel q dus 0,87, vanwege het feit dat p + q = 1. Opgave 1: Wet van Hardy-Weinberg Een populatie van 10.000 individuen voldoet wat betreft de onderlinge voortplanting aan de voorwaarden, genoemd in de wet van Hardy-Weinberg. Van deze populatie is bekend

Nadere informatie

3. Eén gen kan vele allelen hebben. Hoeveel allelen van één gen heeft ieder individu?

3. Eén gen kan vele allelen hebben. Hoeveel allelen van één gen heeft ieder individu? Genetica Vragen bij hoofdstuk 13, 14 en 15 van 'Biology', Campbell, 7e druk Versie 2006 2007 Theorie 1. Hoe noemt men een plant die raszuiver is voor een bepaalde eigenschap? 2. Hoe noemt men planten met

Nadere informatie

Biologie Vraag 1 <A> <B> <C> <D> Vraag 1. Dit zijn een aantal gegevens over een nucleïnezuur.

Biologie Vraag 1 <A> <B> <C> <D> Vraag 1. Dit zijn een aantal gegevens over een nucleïnezuur. Biologie Vraag 1 Dit zijn een aantal gegevens over een nucleïnezuur. 1. Het is een enkelvoudige keten. 2. Het bevat als basen: G A C T. 3. Het varieert naargelang de soort cel binnen één organisme. 4.

Nadere informatie

TENTAMEN BIOCHEMIE (8S135) Prof. Dr. Ir. L. Brunsveld :00 17:00 (totaal 100 punten) 6 opgaven in totaal (aangegeven tijd is indicatie)

TENTAMEN BIOCHEMIE (8S135) Prof. Dr. Ir. L. Brunsveld :00 17:00 (totaal 100 punten) 6 opgaven in totaal (aangegeven tijd is indicatie) TENTAMEN BIOCHEMIE (8S135) Prof. Dr. Ir. L. Brunsveld 25-01-2010 14:00 17:00 (totaal 100 punten) 6 opgaven in totaal (aangegeven tijd is indicatie) 1 (~30 minuten; 20 punten) Onderstaand is een stukje

Nadere informatie

DNA & eiwitsynthese (Junior College Utrecht) Vragen bij COO-programma

DNA & eiwitsynthese (Junior College Utrecht) Vragen bij COO-programma DNA & eiwitsynthese (Junior College Utrecht) Vragen bij COO-programma De vragen die voorkomen in het COO-programma DNA & eiwitsynthese zijn op dit formulier weergegeven. Het is de bedoeling dat je, als

Nadere informatie

biologie vwo 2017-I Gespierder door gendoping

biologie vwo 2017-I Gespierder door gendoping Gespierder door gendoping Het overdragen van genetisch materiaal naar menselijke cellen voor de behandeling van ziektes bevindt zich nog in een experimenteel stadium. Deze techniek zou ook gebruikt kunnen

Nadere informatie

Algemene aspecten van erfelijkheid. Waarom is kennis over erfelijke aspecten van een ziekte belangrijk? Wanneer erfelijkheidsadvies/onderzoek?

Algemene aspecten van erfelijkheid. Waarom is kennis over erfelijke aspecten van een ziekte belangrijk? Wanneer erfelijkheidsadvies/onderzoek? Erfelijke nierziekten: algemene aspecten van erfelijkheid, overerving en erfelijkheidsadvies Nine Knoers Klinisch Geneticus Commissie Erfelijke Nierziekten NVN 4 november 2006 HUMAN GENETICS NIJMEGEN Inhoud

Nadere informatie

Afsluitende les. Leerlingenhandleiding. Wat voor eiwit ben jij? (Expert)

Afsluitende les. Leerlingenhandleiding. Wat voor eiwit ben jij? (Expert) Afsluitende les Leerlingenhandleiding Wat voor eiwit ben jij? (Expert) Deel 1 DNA kan vertaald worden naar aminozuren, die op hun beurt weer coderen voor eiwitten. In het DNA kunnen verschillende mutaties

Nadere informatie

PRAKTISCH MEER OVER ERFELIJKHEID

PRAKTISCH MEER OVER ERFELIJKHEID l a n d e l i j k i n f o r m a t i e c e n t r u m g e z e l s c h a p s d i e r e n PRAKTISCH MEER OVER ERFELIJKHEID over houden van huisdieren Heel wat ziekten en aandoeningen bij dieren zijn (helemaal

Nadere informatie

De volgende vragen testen je kennis van de meest voorkomende vaktermen in de klassieke genetica. Welk woord ontbreekt in de volgende zinnen?

De volgende vragen testen je kennis van de meest voorkomende vaktermen in de klassieke genetica. Welk woord ontbreekt in de volgende zinnen? Populatiegenetica Versie 2006-2007 Vragen bij COO Belangrijke begrippen De volgende vragen testen je kennis van de meest voorkomende vaktermen in de klassieke genetica. Welk woord ontbreekt in de volgende

Nadere informatie

Humane levenscyclus 1

Humane levenscyclus 1 Humane levenscyclus 1 Genexpressie 2 8 september 2011 Doel: Genexpressie (via welke stappen de informatie die in het DNA is opgeslagen gebruikt kan worden om eiwitten te vormen. Differentiële genexpressie

Nadere informatie

Oefenopgaven Biochemie

Oefenopgaven Biochemie 6VW efenopgaven Biochemie Parkinson De ziekte van Parkinson is een neurologische aandoening. Wanneer van een bepaalde soort hersencellen een aanzienlijk deel is afgestorven, komt deze ziekte tot uiting.

Nadere informatie

X-gebonden overerving

X-gebonden overerving 12 Universiteit Gent - UG http://medgen.ugent.be/cmgg/home.php Tel. +32(0)9 240 36 03 X-gebonden overerving Université Libre de Bruxelles - ULB Tel. +32 (0)2 555 31 11 Vrije Universiteit Brussel - VUB

Nadere informatie

Examen VWO. biologie. tijdvak 1 woensdag 23 mei 13.30-16.30 uur

Examen VWO. biologie. tijdvak 1 woensdag 23 mei 13.30-16.30 uur Examen VWO 2012 tijdvak 1 woensdag 23 mei 13.30-16.30 uur biologie Dit examen bestaat uit 38 vragen. Voor dit examen zijn maximaal 68 punten te behalen. Voor elk vraagnummer staat hoeveel punten met een

Nadere informatie

X-gebonden Overerving

X-gebonden Overerving 12 http://www.nki.nl/ Afdeling Genetica van het Universitair Medisch Centrum Groningen http://www.umcgenetica.nl/ X-gebonden Overerving Afdeling Klinische Genetica van het Leids Universitair Medisch Centrum

Nadere informatie

Genetica. Marvin Tersluijsen. CC Naamsvermelding-GelijkDelen 3.0 Nederland licentie.

Genetica. Marvin Tersluijsen. CC Naamsvermelding-GelijkDelen 3.0 Nederland licentie. Auteur Laatst gewijzigd Licentie Webadres Marvin Tersluijsen 08 April 2016 CC Naamsvermelding-GelijkDelen 3.0 Nederland licentie http://maken.wikiwijs.nl/74428 Dit lesmateriaal is gemaakt met Wikiwijsleermiddelenplein.

Nadere informatie

PATIËNTENINFORMATIE. ADRENOGENITAAL SYNDROOM Informatie voor ouders/verzorgers

PATIËNTENINFORMATIE. ADRENOGENITAAL SYNDROOM Informatie voor ouders/verzorgers PATIËNTENINFORMATIE ADRENOGENITAAL SYNDROOM Informatie voor ouders/verzorgers 2 ADRENOGENITAAL SYNDROOM Informatie voor ouders/verzorgers Met deze informatiefolder wil het Maasstad Ziekenhuis u informeren

Nadere informatie

Klinische Genetica. Geslachtsgebonden (X-chromosoom gebonden) recessieve overerving

Klinische Genetica. Geslachtsgebonden (X-chromosoom gebonden) recessieve overerving Klinische Genetica Geslachtsgebonden (X-chromosoom gebonden) recessieve overerving Klinische Genetica Bij uw bezoek aan de polikliniek Klinische Genetica heeft de klinisch geneticus of een genetisch consulent

Nadere informatie

Erfelijkheid. Mendeliaanse wijze van overerven. Véronique Nas 4 oktober 2013

Erfelijkheid. Mendeliaanse wijze van overerven. Véronique Nas 4 oktober 2013 Mendeliaanse wijze van overerven Véronique Nas 4 oktober 2013 1 drie wijzen van overerven: 1 autosomaal dominant 2 autosomaal recessief 3 x- gebonden autosomaal = niet op het geslachtschromosoom x- gebonden

Nadere informatie

Klinische Genetica. Autosomaal dominante overerving

Klinische Genetica. Autosomaal dominante overerving Klinische Genetica Autosomaal dominante overerving Klinische Genetica U bent (of uw kind is) doorverwezen naar de polikliniek Klinische Genetica. Tijdens de eerste afspraak legt een klinisch geneticus

Nadere informatie

biologie bezem vwo 2016-I

biologie bezem vwo 2016-I Slechter horen door kapotte ionkanalen Gehoorverlies kan veroorzaakt worden door omgevingsfactoren, maar vaak is het een erfelijke kwestie. Bij een erfelijke vorm van doofheid ligt de oorzaak veelal in

Nadere informatie

Eindexamen biologie 1-2 vwo 2005-II

Eindexamen biologie 1-2 vwo 2005-II 4 Beoordelingsmodel Aan het juiste antwoord op een meerkeuzevraag worden twee punten toegekend. Bouw en werking nieren 1 terugresorptie: pijl nummer 2 1 ultrafiltratie: pijl nummer 1 1 2 kenmerken zijn:

Nadere informatie

Jongen of meisje? Variaties in de ontwikkeling van het geslacht

Jongen of meisje? Variaties in de ontwikkeling van het geslacht Jongen of meisje? Variaties in de ontwikkeling van het geslacht Inleiding Bij de geboorte van een kind kan het geslacht onduidelijk zijn, waardoor de arts niet direct kan vaststellen of de baby een jongen

Nadere informatie